DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Ntm

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001418383.1 Gene:Ntm / 50864 RGDID:620958 Length:367 Species:Rattus norvegicus


Alignment Length:426 Identity:117/426 - (27%)
Similarity:178/426 - (41%) Gaps:89/426 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 NCIDLTVSNKISSVGAFE------PDFVIP--LENVTIAQGRDATFTCVVNNLGGHRVSGDGSSA 136
            |.|...:...::::..|:      .|...|  ::|||:.||..||..|.::|    ||:      
  Rat    10 NSISWAIFTGLAALCLFQGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDN----RVT------ 64

  Fly   137 PAKVAWIKADAKAILAIHEHVITNND------RLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNT 195
              :|||:  :...||      ...||      |:.:..|....:::.|:.|.:.|.|.|.|.|.|
  Rat    65 --RVAWL--NRSTIL------YAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQT 119

  Fly   196 D--PMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARN 258
            |  | |.....|.|.:.|.|:  |.|.|:.:.||.:..|.|.|.|.|:|.:|||           
  Rat   120 DNHP-KTSRVHLIVQVSPKIV--EISSDISINEGNNISLTCIATGRPEPTVTWR----------- 170

  Fly   259 GSHQKTKAQSV--EGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVG 321
              |...||...  |.|.|.:..|||.:.|.|.|.|||.|...|.:|:|:.|::.|.:..... .|
  Rat   171 --HISPKAVGFVSEDEYLEIQGITREQSGEYECSASNDVAAPVVRRVKVTVNYPPYISEAKG-TG 232

  Fly   322 APVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGG 386
            .||....||.|...|.|.|...|.::: :.::.|.:.  .:.||..:...:...  .:...|:|.
  Rat   233 VPVGQKGTLQCEASAVPSAEFQWFKDD-KRLVEGKKG--VKVENRPFLSRLTFF--NVSEHDYGN 292

  Fly   387 YKCISKNSIGDTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQKDTRSEDGSRNLNGRLYKDRA 451
            |.|::.|.:|.|..:|.|:|:..|....|    |.||....:                      .
  Rat   293 YTCVASNKLGHTNASIMLFELNEPTSSTL----LQEVKTTAL----------------------T 331

  Fly   452 PDQHPASGSDQLLGRGTMRLIG-TFLLALLVLFTAL 486
            |.:.|.:.|:  :..||.|..| .:||.||||...|
  Rat   332 PWKGPGAVSE--VNNGTSRRAGCIWLLPLLVLHLLL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 35/120 (29%)
Ig strand B 115..119 CDD:409353 2/3 (67%)
Ig strand C 139..143 CDD:409353 2/3 (67%)
Ig strand E 174..178 CDD:409353 0/3 (0%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 35/97 (36%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 2/3 (67%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 18/77 (23%)
Ig strand B 328..332 CDD:409353 2/3 (67%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 1/10 (10%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)
NtmNP_001418383.1 Ig 44..132 CDD:472250 32/108 (30%)
Ig strand B 53..57 CDD:409382 2/3 (67%)
Ig strand C 65..69 CDD:409382 2/3 (67%)
Ig strand E 98..102 CDD:409382 0/3 (0%)
Ig strand F 112..117 CDD:409382 2/4 (50%)
Ig strand G 125..128 CDD:409382 0/2 (0%)
Ig_3 136..205 CDD:464046 29/83 (35%)
Ig 223..307 CDD:472250 21/89 (24%)
Ig strand B 239..243 CDD:409408 2/3 (67%)
Ig strand C 252..256 CDD:409408 0/3 (0%)
Ig strand E 278..282 CDD:409408 0/3 (0%)
Ig strand F 292..297 CDD:409408 2/4 (50%)

Return to query results.
Submit another query.