DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr6

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:269 Identity:68/269 - (25%)
Similarity:106/269 - (39%) Gaps:61/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IRWQLLLLLLLGNCIDLT---VSNKISSVGAFE--------------------------PDFVIP 103
            :.|.|||::::.:  |:|   |...|....:.:                          |.::.|
  Fly    11 VAWLLLLVVIVMS--DMTNGGVQGPIEGYNSLDDLLTTTPTPGQAALLLPTAPTAAYTHPKWMEP 73

  Fly   104 L------ENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNND 162
            .      .|||...|:.|..:|.|.||....||           ||:.....||.:..:..|::.
  Fly    74 YFDPSTPRNVTALMGKSAYLSCRVRNLANKTVS-----------WIRHRDIHILTVGSYTYTSDQ 127

  Fly   163 RL-SVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSG-DMMVP 225
            |. :..|.|...|||.|:..:..|||.|.||::|.|::.....|.||:|...|   ..| |:.|.
  Fly   128 RFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATI---LGGPDLHVD 189

  Fly   226 EGGSAKLVCRARGHPKPK--ITWRREDGREII----ARNGSHQKTKAQSVEGEMLTLSKITRSEM 284
            :|.:..|.|..:..|:|.  |.|...:  |:|    :|.|....|:...|....|.:.....::.
  Fly   190 KGSTINLTCTVKFSPEPPAYIFWYHHE--EVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADS 252

  Fly   285 GAYMCIASN 293
            |.|.|..||
  Fly   253 GKYSCAPSN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 35/117 (30%)
ig 102..195 CDD:278476 30/99 (30%)
IG_like 219..307 CDD:214653 22/82 (27%)
Ig 221..307 CDD:299845 21/79 (27%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
dpr6NP_001287018.1 V-set 79..174 CDD:284989 32/105 (30%)
IG_like 80..175 CDD:214653 33/105 (31%)
IG_like 184..271 CDD:214653 21/80 (26%)
IGc2 191..262 CDD:197706 19/73 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.