| Sequence 1: | NP_001138225.1 | Gene: | DIP-beta / 33125 | FlyBaseID: | FBgn0259245 | Length: | 555 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001287018.1 | Gene: | dpr6 / 50296 | FlyBaseID: | FBgn0040823 | Length: | 396 | Species: | Drosophila melanogaster |
| Alignment Length: | 269 | Identity: | 68/269 - (25%) |
|---|---|---|---|
| Similarity: | 106/269 - (39%) | Gaps: | 61/269 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 68 IRWQLLLLLLLGNCIDLT---VSNKISSVGAFE--------------------------PDFVIP 103
Fly 104 L------ENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNND 162
Fly 163 RL-SVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSG-DMMVP 225
Fly 226 EGGSAKLVCRARGHPKPK--ITWRREDGREII----ARNGSHQKTKAQSVEGEMLTLSKITRSEM 284
Fly 285 GAYMCIASN 293 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-beta | NP_001138225.1 | Ig | 98..209 | CDD:472250 | 35/117 (30%) |
| Ig strand B | 115..119 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 139..143 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 174..178 | CDD:409353 | 3/3 (100%) | ||
| Ig strand F | 188..193 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 202..205 | CDD:409353 | 0/2 (0%) | ||
| Ig | 211..307 | CDD:472250 | 23/90 (26%) | ||
| Ig strand B | 230..234 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 243..247 | CDD:409353 | 1/5 (20%) | ||
| Ig strand E | 272..276 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 286..291 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 300..303 | CDD:409353 | |||
| IG_like | 327..405 | CDD:214653 | |||
| Ig strand B | 328..332 | CDD:409353 | |||
| Ig strand C | 341..346 | CDD:409353 | |||
| Ig strand E | 365..376 | CDD:409353 | |||
| Ig strand F | 386..391 | CDD:409353 | |||
| Ig strand G | 399..402 | CDD:409353 | |||
| dpr6 | NP_001287018.1 | FR1 | 79..96 | CDD:409355 | 5/16 (31%) |
| IG_like | 80..175 | CDD:214653 | 33/105 (31%) | ||
| Ig strand A' | 83..85 | CDD:409355 | 1/1 (100%) | ||
| Ig strand B | 89..97 | CDD:409355 | 2/7 (29%) | ||
| CDR1 | 97..104 | CDD:409355 | 3/6 (50%) | ||
| FR2 | 105..114 | CDD:409355 | 4/19 (21%) | ||
| Ig strand C | 105..110 | CDD:409355 | 4/15 (27%) | ||
| CDR2 | 115..129 | CDD:409355 | 3/13 (23%) | ||
| Ig strand D | 129..135 | CDD:409355 | 0/5 (0%) | ||
| FR3 | 130..159 | CDD:409355 | 11/28 (39%) | ||
| Ig strand E | 139..145 | CDD:409355 | 3/5 (60%) | ||
| Ig strand F | 153..160 | CDD:409355 | 4/6 (67%) | ||
| IG_like | 184..271 | CDD:214653 | 21/80 (26%) | ||
| Ig strand B | 194..198 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 209..213 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 240..244 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 254..259 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 268..271 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||