Sequence 1: | NP_001138225.1 | Gene: | DIP-beta / 33125 | FlyBaseID: | FBgn0259245 | Length: | 555 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287018.1 | Gene: | dpr6 / 50296 | FlyBaseID: | FBgn0040823 | Length: | 396 | Species: | Drosophila melanogaster |
Alignment Length: | 269 | Identity: | 68/269 - (25%) |
---|---|---|---|
Similarity: | 106/269 - (39%) | Gaps: | 61/269 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 IRWQLLLLLLLGNCIDLT---VSNKISSVGAFE--------------------------PDFVIP 103
Fly 104 L------ENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNND 162
Fly 163 RL-SVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSG-DMMVP 225
Fly 226 EGGSAKLVCRARGHPKPK--ITWRREDGREII----ARNGSHQKTKAQSVEGEMLTLSKITRSEM 284
Fly 285 GAYMCIASN 293 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-beta | NP_001138225.1 | I-set | 98..209 | CDD:254352 | 35/117 (30%) |
ig | 102..195 | CDD:278476 | 30/99 (30%) | ||
IG_like | 219..307 | CDD:214653 | 22/82 (27%) | ||
Ig | 221..307 | CDD:299845 | 21/79 (27%) | ||
Ig | 311..404 | CDD:299845 | |||
IG_like | 327..405 | CDD:214653 | |||
dpr6 | NP_001287018.1 | V-set | 79..174 | CDD:284989 | 32/105 (30%) |
IG_like | 80..175 | CDD:214653 | 33/105 (31%) | ||
IG_like | 184..271 | CDD:214653 | 21/80 (26%) | ||
IGc2 | 191..262 | CDD:197706 | 19/73 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |