DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr6

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:269 Identity:68/269 - (25%)
Similarity:106/269 - (39%) Gaps:61/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IRWQLLLLLLLGNCIDLT---VSNKISSVGAFE--------------------------PDFVIP 103
            :.|.|||::::.:  |:|   |...|....:.:                          |.::.|
  Fly    11 VAWLLLLVVIVMS--DMTNGGVQGPIEGYNSLDDLLTTTPTPGQAALLLPTAPTAAYTHPKWMEP 73

  Fly   104 L------ENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNND 162
            .      .|||...|:.|..:|.|.||....||           ||:.....||.:..:..|::.
  Fly    74 YFDPSTPRNVTALMGKSAYLSCRVRNLANKTVS-----------WIRHRDIHILTVGSYTYTSDQ 127

  Fly   163 RL-SVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSG-DMMVP 225
            |. :..|.|...|||.|:..:..|||.|.||::|.|::.....|.||:|...|   ..| |:.|.
  Fly   128 RFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATI---LGGPDLHVD 189

  Fly   226 EGGSAKLVCRARGHPKPK--ITWRREDGREII----ARNGSHQKTKAQSVEGEMLTLSKITRSEM 284
            :|.:..|.|..:..|:|.  |.|...:  |:|    :|.|....|:...|....|.:.....::.
  Fly   190 KGSTINLTCTVKFSPEPPAYIFWYHHE--EVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADS 252

  Fly   285 GAYMCIASN 293
            |.|.|..||
  Fly   253 GKYSCAPSN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 35/117 (30%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 3/3 (100%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 23/90 (26%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/5 (20%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353
IG_like 327..405 CDD:214653
Ig strand B 328..332 CDD:409353
Ig strand C 341..346 CDD:409353
Ig strand E 365..376 CDD:409353
Ig strand F 386..391 CDD:409353
Ig strand G 399..402 CDD:409353
dpr6NP_001287018.1 FR1 79..96 CDD:409355 5/16 (31%)
IG_like 80..175 CDD:214653 33/105 (31%)
Ig strand A' 83..85 CDD:409355 1/1 (100%)
Ig strand B 89..97 CDD:409355 2/7 (29%)
CDR1 97..104 CDD:409355 3/6 (50%)
FR2 105..114 CDD:409355 4/19 (21%)
Ig strand C 105..110 CDD:409355 4/15 (27%)
CDR2 115..129 CDD:409355 3/13 (23%)
Ig strand D 129..135 CDD:409355 0/5 (0%)
FR3 130..159 CDD:409355 11/28 (39%)
Ig strand E 139..145 CDD:409355 3/5 (60%)
Ig strand F 153..160 CDD:409355 4/6 (67%)
IG_like 184..271 CDD:214653 21/80 (26%)
Ig strand B 194..198 CDD:409353 1/3 (33%)
Ig strand C 209..213 CDD:409353 1/3 (33%)
Ig strand E 240..244 CDD:409353 1/3 (33%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 268..271 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.