DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and OPCML

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001306032.1 Gene:OPCML / 4978 HGNCID:8143 Length:354 Species:Homo sapiens


Alignment Length:380 Identity:104/380 - (27%)
Similarity:163/380 - (42%) Gaps:66/380 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CGPA-IRWQLLLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGH 127
            ||.. :.|:.|:::.|.....:.....:.|..|..|.   .::|||:.||..||..|.:::    
Human     4 CGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPK---AMDNVTVRQGESATLRCTIDD---- 61

  Fly   128 RVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQH------NDYNTWTLNIRGVKMEDA 186
            ||:        :|||:  :...||      ...||:.|:..      |....:::.|:.|.:.|.
Human    62 RVT--------RVAWL--NRSTIL------YAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDE 110

  Fly   187 GKYMCQVNTD--PMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRR- 248
            |.|.|.|.||  | |.....|.|.:||.|:|  .|.|:.|.||.|..|:|.|.|.|:|.:|||. 
Human   111 GPYTCSVQTDNHP-KTSRVHLIVQVPPQIMN--ISSDITVNEGSSVTLLCLAIGRPEPTVTWRHL 172

  Fly   249 --EDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHP 311
              ::|:..::             |.|.|.:|.|.|.:.|.|.|.|.|.|.....:::|:.|::.|
Human   173 SVKEGQGFVS-------------EDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPP 224

  Fly   312 LVQVPNQLVGAPVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHI 376
            .:..... .|..|.....|.|...|.|.|...|.:|...:....|...: |.:..|..:...   
Human   225 YISKAKN-TGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRI-ENKGRMSTLTFF--- 284

  Fly   377 KRLQSSDFGGYKCISKNSIGDTEGTIRLYEME------RPGKKILRDDDLNEVSK 425
             .:...|:|.|.|::.|.:|:|..:|.|||:.      .||..|   |.:|..|:
Human   285 -NVSEKDYGNYTCVATNKLGNTNASITLYEISPSSAVAGPGAVI---DGVNSASR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 33/118 (28%)
ig 102..195 CDD:278476 26/98 (27%)
IG_like 219..307 CDD:214653 29/90 (32%)
Ig 221..307 CDD:299845 28/88 (32%)
Ig 311..404 CDD:299845 21/92 (23%)
IG_like 327..405 CDD:214653 18/77 (23%)
OPCMLNP_001306032.1 Ig 44..132 CDD:416386 31/108 (29%)
Ig strand A' 44..49 CDD:409353 3/4 (75%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 0/7 (0%)
FR2 64..70 CDD:409353 3/15 (20%)
Ig strand C 64..70 CDD:409353 3/15 (20%)
CDR2 71..83 CDD:409353 4/17 (24%)
Ig strand C' 72..76 CDD:409353 2/9 (22%)
Ig strand C' 80..83 CDD:409353 1/2 (50%)
FR3 84..118 CDD:409353 7/33 (21%)
Ig strand D 87..94 CDD:409353 0/6 (0%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 2/3 (67%)
Ig strand G 123..132 CDD:409353 3/9 (33%)
FR4 125..132 CDD:409353 1/6 (17%)
Ig_3 135..206 CDD:404760 30/85 (35%)
Ig strand A 135..138 CDD:409353 2/2 (100%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 3/8 (38%)
Ig strand C 165..170 CDD:409353 2/4 (50%)
Ig strand C' 171..174 CDD:409353 0/2 (0%)
Ig strand F 198..206 CDD:409353 4/7 (57%)
Ig 224..312 CDD:416386 21/93 (23%)
putative Ig strand A 224..230 CDD:409353 1/5 (20%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 0/3 (0%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143402
Domainoid 1 1.000 45 1.000 Domainoid score I12195
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.