DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and NCAM2

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:629 Identity:139/629 - (22%)
Similarity:217/629 - (34%) Gaps:225/629 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SGCGPAIRW-----------QLLLLLLLGNCIDLTVSNKISSVGAF----------EPDF--VIP 103
            |...||:.|           .....:|..|.:.:...|| |..|.:          |.||  :|.
Human   165 SSPAPAVSWLYHNEEVTTISDNRFAMLANNNLQILNINK-SDEGIYRCEGRVEARGEIDFRDIIV 228

  Fly   104 LENV-------------TIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHE 155
            :.||             |..:|.:.||:|        |.|  ||..|| ::|.:           
Human   229 IVNVPPAISMPQKSFNATAERGEEMTFSC--------RAS--GSPEPA-ISWFR----------- 271

  Fly   156 HVITNNDRLSVQHNDY-----NTWTLNIRGVKMEDAGKYMCQ-VNTDPMKMQTATLEVVIPPDII 214
                 |.:|..::..|     || .|.:|.:...|.|.|:|: .|......:.|.|:|.:.|.||
Human   272 -----NGKLIEENEKYILKGSNT-ELTVRNIINSDGGPYVCRATNKAGEDEKQAFLQVFVQPHII 330

  Fly   215 ---NEETSGDMMVPEGGSAKLVCRARGHPKPKITWRRE-------------DGR-EIIARNGSHQ 262
               ||.|.      |.|...|||.|.|.|.|:|||:|.             ||| |:..::||  
Human   331 QLKNETTY------ENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSLDGRIEVKGQHGS-- 387

  Fly   263 KTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLV-----GA 322
                     ..|.:..:..|:.|.|.|.|::.:... .|.|.|.:.:.|.. :.||.:     |.
Human   388 ---------SSLHIKDVKLSDSGRYDCEAASRIGGH-QKSMYLDIEYAPKF-ISNQTIYYSWEGN 441

  Fly   323 PVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKEN---NMYAI--EMILHIKRLQSS 382
            |    :.:.|:|:::|.|..:|:|         |:..|..|..   ..|:.  :|||.|.....:
Human   442 P----INISCDVKSNPPASIHWRR---------DKLVLPAKNTTNLKTYSTGRKMILEIAPTSDN 493

  Fly   383 DFGGYKCISKNSIG-------------------------------------DTEGTIRLYEMERP 410
            |||.|.|.:.|.||                                     |:.|.:.::..:..
Human   494 DFGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVD 558

  Fly   411 GK-------KILRDDDLNEVSKNEVVQKDTRSEDGSRNLNGRLYKDRA---------------PD 453
            .|       ||:|...:..:.....::.:|..|.....:||:...|.:               |.
Human   559 VKEVASEIWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPS 623

  Fly   454 QH--PASGSDQLLGRGTMRLIGTFLLALLVLFTALAEAGPTTLSCRTKGGRQKKAKETSWNGRRA 516
            .|  |:||.             :|.|::    |...:.|...|....|  .:.|.||..|..::.
Human   624 IHGQPSSGK-------------SFKLSI----TKQDDGGAPILEYIVK--YRSKDKEDQWLEKKV 669

  Fly   517 RDGREDGHAAE---WRQCWERSALSWRR-----------SAPPE 546
            : |.:|....|   |...:|....:..|           |.||:
Human   670 Q-GNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPK 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 32/131 (24%)
ig 102..195 CDD:278476 26/111 (23%)
IG_like 219..307 CDD:214653 28/101 (28%)
Ig 221..307 CDD:299845 28/99 (28%)
Ig 311..404 CDD:299845 29/139 (21%)
IG_like 327..405 CDD:214653 24/119 (20%)
NCAM2XP_011527877.1 Ig1_NCAM-2 46..137 CDD:143274
I-set 47..136 CDD:254352
I-set 142..218 CDD:254352 10/53 (19%)
IGc2 153..214 CDD:197706 10/49 (20%)
Ig 233..326 CDD:299845 27/120 (23%)
I-set 240..323 CDD:254352 26/110 (24%)
Ig5_NCAM-2 325..422 CDD:143278 34/114 (30%)
IG_like 333..420 CDD:214653 30/104 (29%)
IG_like 438..515 CDD:214653 24/89 (27%)
IGc2 439..507 CDD:197706 22/80 (28%)
FN3 521..613 CDD:238020 11/91 (12%)
fn3 619..703 CDD:278470 21/103 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.