DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and NCAM1

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001387553.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:1129 Species:Homo sapiens


Alignment Length:344 Identity:82/344 - (23%)
Similarity:142/344 - (41%) Gaps:54/344 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAK 139
            |..||..:.|.|.             ::|.:. .|:.|....|.|        :|:||...  ..
Human    11 LFFLGTAVSLQVD-------------IVPSQG-EISVGESKFFLC--------QVAGDAKD--KD 51

  Fly   140 VAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTAT 204
            ::|...:.       |.:..|..|:||..||.::.||.|....::|||.|.|.|..:......||
Human    52 ISWFSPNG-------EKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEAT 109

  Fly   205 LEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSV 269
            :.|.|...::.:.........||..|.:||.......|.|.|:.: ||::|.:    :..:...:
Human   110 VNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHK-GRDVILK----KDVRFIVL 169

  Fly   270 EGEMLTLSKITRSEMGAYMC---IASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAP--VLTDVT 329
            ....|.:..|.:::.|.|.|   |.:.|  ....|.:::.|:..|.:|....:|.|.  :...||
Human   170 SNNYLQIRGIKKTDEGTYRCEGRILARG--EINFKDIQVIVNVPPTIQARQNIVNATANLGQSVT 232

  Fly   330 LICNVEASPKAINYWQRENGEMIIA---GDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCIS 391
            |:|:.|..|:....|.:: ||.|..   .::|..::..:.       |.||::..:|...|.||:
Human   233 LVCDAEGFPEPTMSWTKD-GEQIEQEEDDEKYIFSDDSSQ-------LTIKKVDKNDEAEYICIA 289

  Fly   392 KNSIGDTEGTIRLYEMERP 410
            :|..|:.:.||.|....:|
Human   290 ENKAGEQDATIHLKVFAKP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 28/110 (25%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 2/3 (67%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 211..307 CDD:472250 19/98 (19%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/7 (29%)
Ig strand G 300..303 CDD:409353 1/2 (50%)
IG_like 327..405 CDD:214653 22/80 (28%)
Ig strand B 328..332 CDD:409353 3/3 (100%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 1/10 (10%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)
NCAM1NP_001387553.1 IgI_1_NCAM-1 20..116 CDD:409451 31/126 (25%)
Ig strand A 20..25 CDD:409451 2/17 (12%)
Ig strand A' 28..32 CDD:409451 0/4 (0%)
Ig strand B 34..44 CDD:409451 3/17 (18%)
Ig strand C 50..56 CDD:409451 1/5 (20%)
Ig strand C' 59..61 CDD:409451 0/8 (0%)
Ig strand D 69..75 CDD:409451 2/5 (40%)
Ig strand E 77..85 CDD:409451 3/7 (43%)
Ig strand F 92..100 CDD:409451 4/7 (57%)
Ig strand G 104..115 CDD:409451 3/10 (30%)
IG_like 124..190 CDD:214653 15/70 (21%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 1/3 (33%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig 211..307 CDD:472250 27/103 (26%)
Ig strand B 231..235 CDD:409353 3/3 (100%)
Ig strand C 244..248 CDD:409353 0/3 (0%)
Ig strand E 270..274 CDD:409353 1/10 (10%)
Ig strand F 284..289 CDD:409353 2/4 (50%)
Ig strand G 297..300 CDD:409353 0/2 (0%)
IgI_NCAM-1 306..412 CDD:143277 1/3 (33%)
Ig strand A 306..311 CDD:143277 1/3 (33%)
Ig strand A' 315..319 CDD:143277
Ig strand B 324..332 CDD:143277
Ig strand C 338..344 CDD:143277
Ig strand C' 347..350 CDD:143277
Ig strand D 368..374 CDD:143277
Ig strand E 377..383 CDD:143277
Ig strand F 391..399 CDD:143277
Ig strand G 402..412 CDD:143277
IG_like 421..499 CDD:214653
Ig strand B 432..436 CDD:409353
Ig strand C 445..449 CDD:409353
Ig strand E 472..476 CDD:409353
Ig strand F 486..491 CDD:409353
fn3 511..598 CDD:394996
fn3 612..693 CDD:394996
PRK12323 <913..1108 CDD:481241
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.