DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and LOC4576145

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_061497048.1 Gene:LOC4576145 / 4576145 VectorBaseID:AGAMI1_011278 Length:493 Species:Anopheles gambiae


Alignment Length:135 Identity:27/135 - (20%)
Similarity:47/135 - (34%) Gaps:59/135 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NKVCDHV-GTRTQHECVL-------------------------------------KFLQLPIQDP 33
            |.:|||: .|.:...|.|                                     :|.:||::: 
Mosquito   108 NTICDHILSTLSDVNCFLLHKKFREFDCQNHAHKTLEYILYNLARMVVVDKRVDVEFYRLPVEE- 171

  Fly    34 YLTENLSSDKAEAAPGGAAKEVLGPL---------AFQPVPFSQSGNPVMSTVAFLASVVDPQVA 89
             :...|||::..........||:...         .|:|:        :||||.|||  :|.|:|
Mosquito   172 -VKHLLSSEEVNVEQETQIIEVINQWIAADFENRDKFRPM--------LMSTVRFLA--LDQQIA 225

  Fly    90 AAATK 94
            .:.::
Mosquito   226 KSLSQ 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250
Ig strand B 115..119 CDD:409353
Ig strand C 139..143 CDD:409353
Ig strand E 174..178 CDD:409353
Ig strand F 188..193 CDD:409353
Ig strand G 202..205 CDD:409353
Ig 211..307 CDD:472250
Ig strand B 230..234 CDD:409353
Ig strand C 243..247 CDD:409353
Ig strand E 272..276 CDD:409353
Ig strand F 286..291 CDD:409353
Ig strand G 300..303 CDD:409353
IG_like 327..405 CDD:214653
Ig strand B 328..332 CDD:409353
Ig strand C 341..346 CDD:409353
Ig strand E 365..376 CDD:409353
Ig strand F 386..391 CDD:409353
Ig strand G 399..402 CDD:409353
LOC4576145XP_061497048.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.