DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and MOG

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001350539.1 Gene:MOG / 4340 HGNCID:7197 Length:295 Species:Homo sapiens


Alignment Length:157 Identity:31/157 - (19%)
Similarity:56/157 - (35%) Gaps:35/157 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PAIRWQLLLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVS 130
            |:.....||||||          ::||..|.:...:.|...:....|.:....|        |:|
Human    10 PSCLCSFLLLLLL----------QVSSSYAGQFRVIGPRHPIRALVGDEVELPC--------RIS 56

  Fly   131 GDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDY-------------NTWTLNIRGVK 182
            ...::...:|.|.:.....::.::.:   ..|:...|..:|             ...||.||.|:
Human    57 PGKNATGMEVGWYRPPFSRVVHLYRN---GKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVR 118

  Fly   183 MEDAGKYMCQVNTDPMKMQTATLEVVI 209
            ..|.|.:.|... |....:.|.:|:.:
Human   119 FSDEGGFTCFFR-DHSYQEEAAMELKV 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 21/123 (17%)
ig 102..195 CDD:278476 18/105 (17%)
IG_like 219..307 CDD:214653
Ig 221..307 CDD:299845
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
MOGNP_001350539.1 Ig_MOG_like 46..144 CDD:319291 20/109 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.