DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr17

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:314 Identity:73/314 - (23%)
Similarity:112/314 - (35%) Gaps:92/314 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KESGERIADISCSQEHTTKFSPKLSQVAKHRKLAQLEIASGSGLVGLGTGTGTGSGCGPAIRWQL 72
            |.|.|.:. :|..::....|:.:.|.:|.||                    ..|.|.|.|:|..|
  Fly   365 KTSSEAVT-MSPEEQRRQMFNEQHSYLAAHR--------------------DGGDGAGSAVRRNL 408

  Fly    73 LLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAP 137
                                        .:|:.|:|...|..|...|.:     ||:|      .
  Fly   409 ----------------------------TMPVLNITAQMGNHAYMPCQI-----HRLS------D 434

  Fly   138 AKVAWIKADAKAILAIHEHVITNNDRL-SVQHNDYN-TWTLNIRGVKMEDAGKYMCQVNTDPMKM 200
            ..|:|::.....|:::.|.....::|. |:...|:: ||:|.|:.|:..|||.|.||:.|:|...
  Fly   435 KPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPSDAGWYECQMATEPKLS 499

  Fly   201 QTATLEVVIPPDIINEETSGDM--MVPEGGSAKLVCRARGHPKP-----------KIT------- 245
            ....|::|.|    ..|..||.  .|..|....|.|..||...|           ||:       
  Fly   500 AKVHLQIVKP----KTELIGDQSRFVKAGSKVALHCIVRGTLDPPKYIIWFRGQKKISDSDERTG 560

  Fly   246 WRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTV 299
            |..:..|.|....|.:|.|...      |.:..:.:.:.|.|.|..||.|..:|
  Fly   561 WYTQLDRNIFGTVGDNQNTIGS------LIIPLVRKEDSGNYTCQPSNSVSVSV 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 30/112 (27%)
ig 102..195 CDD:278476 27/94 (29%)
IG_like 219..307 CDD:214653 25/101 (25%)
Ig 221..307 CDD:299845 24/99 (24%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 24/87 (28%)
Ig 415..507 CDD:299845 28/102 (27%)
IG_like 521..612 CDD:214653 23/94 (24%)
IGc2 524..605 CDD:197706 20/86 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12107
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.