DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr5

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:300 Identity:74/300 - (24%)
Similarity:120/300 - (40%) Gaps:71/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TKFSPKLSQVAKHRKLAQL--EIASGSGLVGLGTGTGTGSGCGPAIRWQLLLLLLLGNCIDLTVS 87
            |:.||.:.:|..:.:..|:  |:                     .:.:.:.||:::|....:...
  Fly    17 TESSPLIGKVISNSRAPQIAHEM---------------------LVEYFMALLVIMGLTAPVDKQ 60

  Fly    88 NKISS------VGAFEPDFVIP---------LENVT-----IAQGRDATFTCVVNNLGGHRVSGD 132
            ::.||      ..|.|...:||         .:|.|     .|.|..|...|.|.:||...||  
  Fly    61 SRRSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVS-- 123

  Fly   133 GSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHND-YNTWTLNIRGVKMEDAGKYMCQVNTD 196
                     ||:.....||.|.....||:.|...:|.| .:.|.|.|..|:..|||.|.|||:|:
  Fly   124 ---------WIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTE 179

  Fly   197 PMKMQTATLEVVIPPD---IINEETSGDMMVPEGGSAKLVCRARGHPKP--KITWRREDGREII- 255
            | |:..|...||:...   :.|.|    :.:..|....|.|.|...|.|  .:.|.::  .|:: 
  Fly   180 P-KISLAYKLVVVTSKAQILANRE----LFIQSGSDINLTCIAPQAPGPYTHMLWHKD--TELVS 237

  Fly   256 --ARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASN 293
              ||.|...::: |.::...|.:|::..::.|.|.|.|.|
  Fly   238 DSARGGIRVESE-QQMKTSNLVISRVQHTDSGNYTCSADN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 39/125 (31%)
ig 102..195 CDD:278476 34/107 (32%)
IG_like 219..307 CDD:214653 18/79 (23%)
Ig 221..307 CDD:299845 18/77 (23%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
dpr5NP_650080.3 V-set 95..191 CDD:284989 36/107 (34%)
IG_like 98..179 CDD:214653 30/91 (33%)
IG_like 206..278 CDD:214653 18/73 (25%)
Ig 211..278 CDD:143165 17/68 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.