DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Ama

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:357 Identity:86/357 - (24%)
Similarity:148/357 - (41%) Gaps:48/357 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 QLLLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSS 135
            :|.||:.|..|:.:::.:.:|:     |......::|..:.|....|.|.|..:|          
  Fly    11 RLRLLIGLIFCLAISLDSVLSA-----PVISQISKDVVASVGDSVEFNCTVEEVG---------- 60

  Fly   136 APAKVAWIK----ADAKAILAIHEHVITNNDRLSVQHNDYNT------------WTLNIRGVKME 184
             ...|:|.|    :|..::      |::..:.||:....||.            :|..|:.:::.
  Fly    61 -QLSVSWAKRPSESDTNSV------VLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVS 118

  Fly   185 DAGKYMCQVNTDPMKMQTATLEVVI-PPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRR 248
            |.|.|.|||.....:..|..|.:.| .|.:|.|.|....:|.||.:.:|.|.|.|.|||.|:|.|
  Fly   119 DMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAR 183

  Fly   249 EDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLV 313
            |....:.|  |.|...:      ..|.:..:.|.:.|.|.|||.||......:.::::|.|.|.:
  Fly   184 EHNAVMPA--GGHLLAE------PTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQI 240

  Fly   314 QVPNQLVGAPVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKR 378
            .|....:...|.....|.|:|:..|.....|.: ||..:.:...:.:....::......:|.|..
  Fly   241 AVQRPKIAQMVSHSAELECSVQGYPAPTVVWHK-NGVPLQSSRHHEVANTASSSGTTTSVLRIDS 304

  Fly   379 LQSSDFGGYKCISKNSIGDTEGTIRLYEMERP 410
            :...|||.|.|.:.|.:|..:..:.|::...|
  Fly   305 VGEEDFGDYYCNATNKLGHADARLHLFQTVIP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 26/126 (21%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 1/3 (33%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 211..307 CDD:472250 30/95 (32%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 16/77 (21%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 1/10 (10%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)
AmaNP_731114.2 I-set 33..143 CDD:400151 26/126 (21%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 63..68 CDD:409353 2/4 (50%)
Ig strand E 101..112 CDD:409353 1/10 (10%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 136..139 CDD:409353 1/2 (50%)
Ig_3 146..220 CDD:464046 28/81 (35%)
I-set 254..330 CDD:400151 16/76 (21%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 298..302 CDD:409353 1/3 (33%)
Ig strand F 312..317 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.