DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr16

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:269 Identity:62/269 - (23%)
Similarity:92/269 - (34%) Gaps:87/269 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLS- 165
            :|..|.|:..|:.|...|.:|...|..:|           |::...:.|:|:......|:.|.: 
  Fly   203 LPPLNATVQAGQHAYLPCKLNQHSGKPLS-----------WVRLRDEHIIAVDHTTFINDARFAS 256

  Fly   166 -VQHNDYNT--------------------------------------WTLNIRGVKMEDAGKYMC 191
             :|.....|                                      |||.|:.|.:||||.|.|
  Fly   257 LLQSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYEC 321

  Fly   192 QVNTDPMKMQTATLEVVIPPDIINEETSGD--MMVPEGGSAKLVCRARGH-PKPK-ITWRREDGR 252
            |:.|:|.......|.|:.|    ..|..||  ..|..|...:|.|..||. ..|| |.|.|.| :
  Fly   322 QLATEPKMSAKVQLFVITP----RTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGD-Q 381

  Fly   253 EIIARNGSHQKTKAQS---------VEGE---------MLTLSKITRSEMGAYMCIASNGVPPTV 299
            ::.|.|   :.:.|||         :.|.         .|.:..:.:...|.|.|      .|..
  Fly   382 QVTAEN---EASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTC------EPEN 437

  Fly   300 SKRMKLQVH 308
            |....:|:|
  Fly   438 SAAASMQLH 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 32/146 (22%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 3/3 (100%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 27/117 (23%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 2/4 (50%)
Ig strand E 272..276 CDD:409353 1/12 (8%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 1/2 (50%)
IG_like 327..405 CDD:214653
Ig strand B 328..332 CDD:409353
Ig strand C 341..346 CDD:409353
Ig strand E 365..376 CDD:409353
Ig strand F 386..391 CDD:409353
Ig strand G 399..402 CDD:409353
dpr16NP_001287169.1 IG_like 352..447 CDD:214653 26/105 (25%)
Ig strand B 358..362 CDD:409353 1/3 (33%)
Ig strand C 373..377 CDD:409353 1/3 (33%)
Ig strand E 416..420 CDD:409353 1/3 (33%)
Ig strand F 430..435 CDD:409353 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.