Sequence 1: | NP_001138225.1 | Gene: | DIP-beta / 33125 | FlyBaseID: | FBgn0259245 | Length: | 555 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_612066.1 | Gene: | dpr20 / 38101 | FlyBaseID: | FBgn0035170 | Length: | 525 | Species: | Drosophila melanogaster |
Alignment Length: | 207 | Identity: | 51/207 - (24%) |
---|---|---|---|
Similarity: | 83/207 - (40%) | Gaps: | 33/207 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 106 NVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIK----------ADAKAILAIHEHVITN 160
Fly 161 NDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSGDMMVP 225
Fly 226 E----GGSAKLVCRAR--GHPKPKITWRREDG--REIIARNGSHQKTKAQSVEGEMLTLS--KIT 280
Fly 281 RSEMGAYMCIAS 292 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-beta | NP_001138225.1 | I-set | 98..209 | CDD:254352 | 27/112 (24%) |
ig | 102..195 | CDD:278476 | 23/98 (23%) | ||
IG_like | 219..307 | CDD:214653 | 21/84 (25%) | ||
Ig | 221..307 | CDD:299845 | 20/82 (24%) | ||
Ig | 311..404 | CDD:299845 | |||
IG_like | 327..405 | CDD:214653 | |||
dpr20 | NP_612066.1 | IG_like | 278..365 | CDD:214653 | 23/97 (24%) |
Ig | 279..378 | CDD:299845 | 25/109 (23%) | ||
Ig | 400..471 | CDD:299845 | 18/71 (25%) | ||
IG_like | 402..480 | CDD:214653 | 19/71 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |