DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr20

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:207 Identity:51/207 - (24%)
Similarity:83/207 - (40%) Gaps:33/207 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 NVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIK----------ADAKAILAIHEHVITN 160
            |:|:..|......|.::.|....||           |::          .:|..:|.:..|..|.
  Fly   278 NLTVQAGSSIHLNCRISLLQDKTVS-----------WVRHNTQDEGKDNGNALDLLTVGMHTYTG 331

  Fly   161 NDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSGDMMVP 225
            :.|..::....|.|.|.|..||.:|...|.||::|.|.::....|.|..|..:|.:|. ||.:..
  Fly   332 DKRYKMEFQYPNNWRLKITNVKKDDEAIYECQISTHP
PRVIQINLHVNAPKVMIVDEV-GDPLQE 395

  Fly   226 E----GGSAKLVCRAR--GHPKPKITWRREDG--REIIARNGSHQKTKAQSVEGEMLTLS--KIT 280
            :    ..:.:|.|..|  ......:.|:..|.  ...:.|.|...||:... :|...|||  ||:
  Fly   396 KYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELME-DGANSTLSIAKIS 459

  Fly   281 RSEMGAYMCIAS 292
            :::.|.|.|..|
  Fly   460 KTDSGNYTCSIS 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 27/112 (24%)
Ig strand B 115..119 CDD:409353 0/3 (0%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 2/3 (67%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 23/92 (25%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 0/3 (0%)
Ig strand E 272..276 CDD:409353 0/3 (0%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353
IG_like 327..405 CDD:214653
Ig strand B 328..332 CDD:409353
Ig strand C 341..346 CDD:409353
Ig strand E 365..376 CDD:409353
Ig strand F 386..391 CDD:409353
Ig strand G 399..402 CDD:409353
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 24/100 (24%)
IG_like 278..365 CDD:214653 23/97 (24%)
Ig strand B 287..291 CDD:409382 0/3 (0%)
Ig strand C 300..304 CDD:409382 2/14 (14%)
Ig strand E 345..349 CDD:409382 2/3 (67%)
Ig strand F 359..364 CDD:409382 2/4 (50%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 19/71 (27%)
Ig strand B 404..408 CDD:409353 1/3 (33%)
Ig strand C 417..423 CDD:409353 0/5 (0%)
Ig strand E 451..455 CDD:409353 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.