DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr20

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:207 Identity:51/207 - (24%)
Similarity:83/207 - (40%) Gaps:33/207 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 NVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIK----------ADAKAILAIHEHVITN 160
            |:|:..|......|.::.|....||           |::          .:|..:|.:..|..|.
  Fly   278 NLTVQAGSSIHLNCRISLLQDKTVS-----------WVRHNTQDEGKDNGNALDLLTVGMHTYTG 331

  Fly   161 NDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSGDMMVP 225
            :.|..::....|.|.|.|..||.:|...|.||::|.|.::....|.|..|..:|.:|. ||.:..
  Fly   332 DKRYKMEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEV-GDPLQE 395

  Fly   226 E----GGSAKLVCRAR--GHPKPKITWRREDG--REIIARNGSHQKTKAQSVEGEMLTLS--KIT 280
            :    ..:.:|.|..|  ......:.|:..|.  ...:.|.|...||:... :|...|||  ||:
  Fly   396 KYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELME-DGANSTLSIAKIS 459

  Fly   281 RSEMGAYMCIAS 292
            :::.|.|.|..|
  Fly   460 KTDSGNYTCSIS 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 27/112 (24%)
ig 102..195 CDD:278476 23/98 (23%)
IG_like 219..307 CDD:214653 21/84 (25%)
Ig 221..307 CDD:299845 20/82 (24%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
dpr20NP_612066.1 IG_like 278..365 CDD:214653 23/97 (24%)
Ig 279..378 CDD:299845 25/109 (23%)
Ig 400..471 CDD:299845 18/71 (25%)
IG_like 402..480 CDD:214653 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.