DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and robo1

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster


Alignment Length:345 Identity:84/345 - (24%)
Similarity:147/345 - (42%) Gaps:51/345 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 NCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIK 144
            |.:....|:....:...:|.|:...::..:..|:.|||.|.|           |...|.||.|.|
  Fly   237 NLVGTRESSYAKLIVQVKPYFMKEPKDQVMLYGQTATFHCSV-----------GGDPPPKVLWKK 290

  Fly   145 ADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQT-ATLEVV 208
            .:....::          |..:.|::.   :|.|..:...|.|.|:|:.:.:..::.. |:|.|.
  Fly   291 EEGNIPVS----------RARILHDEK---SLEISNITPTDEGTYVCEAHNNVGQISARASLIVH 342

  Fly   209 IPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGE- 272
            .||:.....:  :..|...|..:|.|.|.|:|.|.:.|.:|....::..|.||.:   |.|..: 
  Fly   343 APPNFTKRPS--NKKVGLNGVVQLPCMASGNPPPSVFWTKEGVSTLMFPNSSHGR---QHVAADG 402

  Fly   273 MLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHF-----HPLVQV--PNQLVGAPVLTDVTL 330
            .|.::.:.:.:.|.|:|.|.: |..:.:.|:.|||..     .|::|:  .||.:  |..:..||
  Fly   403 TLQITDVRQEDEGYYVCSAFS-VVDSSTVRVFLQVSSLDERPPPIIQIGPANQTL--PKGSVATL 464

  Fly   331 ICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSI 395
            .|....:|.....|..: |..:.||:||::.:..:        |.:..||.||.|.|.|.:....
  Fly   465 PCRATGNPSPRIKWFHD-GHAVQAGNRYSIIQGSS--------LRVDDLQLSDSGTYTCTASGER 520

  Fly   396 GDTEGTIRLYEMERPGKKIL 415
            |:|.....| .:|:||...|
  Fly   521 GETSWAATL-TVEKPGSTSL 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 25/111 (23%)
Ig strand B 115..119 CDD:409353 3/3 (100%)
Ig strand C 139..143 CDD:409353 2/3 (67%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 1/3 (33%)
Ig 211..307 CDD:472250 24/96 (25%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 0/3 (0%)
Ig strand E 272..276 CDD:409353 1/4 (25%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 20/77 (26%)
Ig strand B 328..332 CDD:409353 2/3 (67%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 1/10 (10%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)
robo1NP_476899.1 Ig 56..151 CDD:472250
Ig strand B 73..77 CDD:409353
Ig strand C 86..90 CDD:409353
Ig strand E 111..115 CDD:409353
Ig strand F 129..134 CDD:409353
Ig strand G 143..146 CDD:409353
IgI_2_Robo 158..251 CDD:409389 2/13 (15%)
Ig strand A 158..161 CDD:409389
Ig strand A' 163..167 CDD:409389
Ig strand B 171..178 CDD:409389
Ig strand C 186..191 CDD:409389
Ig strand C' 193..196 CDD:409389
Ig strand D 209..213 CDD:409389
Ig strand E 216..222 CDD:409389
Ig strand F 229..237 CDD:409389 84/345 (24%)
Ig strand G 240..251 CDD:409389 1/10 (10%)
IgI_3_Robo 258..341 CDD:409390 22/106 (21%)
Ig strand A 258..261 CDD:409390 0/2 (0%)
Ig strand A' 263..267 CDD:409390 0/3 (0%)
Ig strand B 270..279 CDD:409390 5/19 (26%)
Ig strand C 285..290 CDD:409390 3/4 (75%)
Ig strand C' 293..296 CDD:409390 0/2 (0%)
Ig strand D 299..304 CDD:409390 1/4 (25%)
Ig strand E 305..313 CDD:409390 2/10 (20%)
Ig strand F 320..328 CDD:409390 3/7 (43%)
Ig strand G 331..341 CDD:409390 2/9 (22%)
Ig 346..437 CDD:472250 24/96 (25%)
Ig strand B 362..366 CDD:409353 1/3 (33%)
Ig strand C 375..379 CDD:409353 0/3 (0%)
Ig strand E 402..406 CDD:409353 1/3 (33%)
Ig strand F 416..421 CDD:409353 2/4 (50%)
Ig strand G 429..432 CDD:409353 0/2 (0%)
Ig 446..531 CDD:472250 25/96 (26%)
Ig strand B 462..466 CDD:409544 2/3 (67%)
Ig strand C 475..479 CDD:409544 0/3 (0%)
Ig strand E 497..501 CDD:409544 1/11 (9%)
FN3 507..>916 CDD:442628 12/34 (35%)
Ig strand F 511..516 CDD:409544 2/4 (50%)
Ig strand G 524..527 CDD:409544 0/2 (0%)
FN3 549..637 CDD:238020
fn3 770..855 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.