DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and robo1

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster


Alignment Length:345 Identity:84/345 - (24%)
Similarity:147/345 - (42%) Gaps:51/345 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 NCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIK 144
            |.:....|:....:...:|.|:...::..:..|:.|||.|.|           |...|.||.|.|
  Fly   237 NLVGTRESSYAKLIVQVKPYFMKEPKDQVMLYGQTATFHCSV-----------GGDPPPKVLWKK 290

  Fly   145 ADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQT-ATLEVV 208
            .:....::          |..:.|::.   :|.|..:...|.|.|:|:.:.:..::.. |:|.|.
  Fly   291 EEGNIPVS----------RARILHDEK---SLEISNITPTDEGTYVCEAHNNVGQISARASLIVH 342

  Fly   209 IPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGE- 272
            .||:.....:  :..|...|..:|.|.|.|:|.|.:.|.:|....::..|.||.:   |.|..: 
  Fly   343 APPNFTKRPS--NKKVGLNGVVQLPCMASGNPPPSVFWTKEGVSTLMFPNSSHGR---QHVAADG 402

  Fly   273 MLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHF-----HPLVQV--PNQLVGAPVLTDVTL 330
            .|.::.:.:.:.|.|:|.|.: |..:.:.|:.|||..     .|::|:  .||.:  |..:..||
  Fly   403 TLQITDVRQEDEGYYVCSAFS-VVDSSTVRVFLQVSSLDERPPPIIQIGPANQTL--PKGSVATL 464

  Fly   331 ICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSI 395
            .|....:|.....|..: |..:.||:||::.:..:        |.:..||.||.|.|.|.:....
  Fly   465 PCRATGNPSPRIKWFHD-GHAVQAGNRYSIIQGSS--------LRVDDLQLSDSGTYTCTASGER 520

  Fly   396 GDTEGTIRLYEMERPGKKIL 415
            |:|.....| .:|:||...|
  Fly   521 GETSWAATL-TVEKPGSTSL 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 25/111 (23%)
ig 102..195 CDD:278476 20/92 (22%)
IG_like 219..307 CDD:214653 23/88 (26%)
Ig 221..307 CDD:299845 23/86 (27%)
Ig 311..404 CDD:299845 25/94 (27%)
IG_like 327..405 CDD:214653 20/77 (26%)
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352 2/13 (15%)
Ig2_Robo 159..251 CDD:143201 2/13 (15%)
I-set 255..341 CDD:254352 24/109 (22%)
Ig3_Robo 272..341 CDD:143202 21/92 (23%)
IG_like 351..436 CDD:214653 23/90 (26%)
Ig 362..444 CDD:299845 23/85 (27%)
I-set 445..531 CDD:254352 26/97 (27%)
IGc2 459..521 CDD:197706 18/70 (26%)
FN3 549..637 CDD:238020
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.