DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and CG13506

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_611666.2 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:335 Identity:80/335 - (23%)
Similarity:132/335 - (39%) Gaps:54/335 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNND 162
            |.|.:....|....|.|....|...|.   ::|.       .|.|.|  .:.|:|..::.|  :.
  Fly    70 PYFDVTDLRVEAKPGDDVILNCDARNF---QLSN-------AVVWYK--NRIIIANGQNPI--SQ 120

  Fly   163 RLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEE---TSGDMMV 224
            |:....|:    ::.:|.|..||:..|.|::....::..|| |.|.....|:.::   |......
  Fly   121 RVQCMLNN----SILLRNVSPEDSDDYYCEILPQRVRQHTA-LRVGARLSILCDDRDITDRSQTF 180

  Fly   225 PEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGE--MLTLSKITRSEMGAY 287
            .:|...||.||........|.|...|      .||     :..||:.:  ::.|..:.....|.|
  Fly   181 RQGDHHKLECRTYLPDNATIKWSFND------LNG-----QPSSVDNQNGVIILDNVDEKNAGDY 234

  Fly   288 MCIASNGV--PP--TVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNVEASPKAINYWQREN 348
            .|:|.:|.  ||  ||    .:.|.:.|:|......|.........|.||..|.|...:|:.:: 
  Fly   235 QCLADDGSRHPPHGTV----HIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKD- 294

  Fly   349 GEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRL-YEMERP-- 410
            |:.:...|:|:|.:..:|.:. ...|.::.:..||.|.|.|..:|:||..|..:.: |..|.|  
  Fly   295 GKTLQLSDKYSLKDSVHNDHN-RTTLIVREVTDSDLGEYLCQVENAIGSNEVKVHVSYNPETPQF 358

  Fly   411 ------GKKI 414
                  |.|:
  Fly   359 EDMTVEGNKV 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 26/110 (24%)
Ig strand B 115..119 CDD:409353 0/3 (0%)
Ig strand C 139..143 CDD:409353 1/3 (33%)
Ig strand E 174..178 CDD:409353 0/3 (0%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 2/2 (100%)
Ig 211..307 CDD:472250 24/104 (23%)
Ig strand B 230..234 CDD:409353 2/3 (67%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 0/5 (0%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 21/78 (27%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 2/10 (20%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 1/2 (50%)
CG13506NP_611666.2 Ig_3 69..146 CDD:464046 21/93 (23%)
Ig_3 173..238 CDD:464046 17/75 (23%)
Ig 258..349 CDD:472250 24/92 (26%)
Ig strand B 275..279 CDD:409353 1/3 (33%)
Ig strand C 288..292 CDD:409353 1/3 (33%)
Ig strand E 317..321 CDD:409353 1/3 (33%)
Ig strand F 331..336 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.