DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and wrapper

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:382 Identity:98/382 - (25%)
Similarity:163/382 - (42%) Gaps:60/382 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LLLLLLLGNC-------IDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRV 129
            ||..|:||..       .||..|.|..|:    |..|...||.|:      ...|.:|       
  Fly    12 LLAALILGQVQAELDFNNDLENSQKFKSI----PTTVKTYENDTV------QLPCTLN------- 59

  Fly   130 SGDGSSAPAK-VAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQV 193
                  .|.: |.|.:.|...:.:.|.. :...||:.:..|.    :|.:..|:..|.|.|.|::
  Fly    60 ------TPFRYVRWHRDDVALVDSRHPE-LPPPDRIMLWPNG----SLQVANVQSSDTGDYYCEM 113

  Fly   194 NTDP-MKMQTATLEVVIPPDIINEETSGDMMVPE-GGSAKLVCRARGHPKPKITWRREDGREIIA 256
            |:|. ..:|...:||.:.|.::.|.:  |:.... |...::||.|:|.|:|.||||         
  Fly   114 NSDSGHVVQQHAIEVQLAPQVLIEPS--DLTEQRIGAIFEVVCEAQGVPQPVITWR--------- 167

  Fly   257 RNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVG 321
            .||:..:.::.:...:.|.|...:|::.|...|:|||||.......:.|.|.|.|.|.:|..:|.
  Fly   168 LNGNVIQPQSNTGNRQSLILEIKSRNQAGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVVY 232

  Fly   322 APVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKE--------NNMYAIEMILHIKR 378
            ..:.:...|.|.|||:|.|...| ..:|..:..|......|.|        :.:.|:..:|.:|.
  Fly   233 TKLGSRAHLECIVEAAPAATVKW-FHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRHMLVVKS 296

  Fly   379 LQSSDFGGYKCISKNSIGDTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQKDTRS 435
            ::::|.|.|:|.:.|.|....|::.|  ..||...:.:.:...:.|.:.|:...|.|
  Fly   297 VRNADMGQYECRASNQISVKSGSVEL--TGRPMPCLFKINPGTQSSTSHVLVWQTES 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 26/112 (23%)
Ig strand B 115..119 CDD:409353 0/3 (0%)
Ig strand C 139..143 CDD:409353 1/4 (25%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 27/96 (28%)
Ig strand B 230..234 CDD:409353 0/3 (0%)
Ig strand C 243..247 CDD:409353 2/3 (67%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 1/4 (25%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 22/85 (26%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 2/10 (20%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 1/2 (50%)
wrapperNP_477404.1 IG_like 41..118 CDD:214653 23/100 (23%)
Ig strand B 52..56 CDD:409353 0/9 (0%)
Ig strand C 64..68 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 1/7 (14%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 1/2 (50%)
Ig 133..219 CDD:472250 26/96 (27%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 2/3 (67%)
Ig strand E 183..187 CDD:409353 1/3 (33%)
Ig strand F 197..202 CDD:409353 1/4 (25%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 222..311 CDD:464046 23/89 (26%)
FN3 339..431 CDD:238020 4/13 (31%)

Return to query results.
Submit another query.