DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Lac

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:349 Identity:87/349 - (24%)
Similarity:163/349 - (46%) Gaps:54/349 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCV----VNNLGGHRVSGDGSSAPA 138
            :.||:..|:...|         ||    ..|:|| |..|.:.:    :.::|| .|..|.|...|
  Fly     6 ISNCVWSTLLLAI---------FV----QQTLAQ-RTPTISYITQEQIKDIGG-TVEFDCSVQYA 55

  Fly   139 K---VAWIKADAKAI-LAIHEHVITNNDRLSVQHN-DYNTWTLNIRGVKMEDAGKYMCQVNTDPM 198
            |   |.::|.|:..: |:....::..:.|.|:::: :.:|:.|.|:.::..|||.|.|||....:
  Fly    56 KEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTV 120

  Fly   199 KMQTATLEV-VIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQ 262
            ...:|.::: |..|.:|::.::..::..||...::.|.|.|:|.|.||||||        |.:..
  Fly   121 HKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRE--------NNAIL 177

  Fly   263 KTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTD 327
            .|.:.:..|..|.:..:.:.:.|.|.|:|.|||.....:.:.::|.|.|::.||...:|..:..|
  Fly   178 PTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYD 242

  Fly   328 VTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAI----------EMILHIKRLQSS 382
            :.|.|::||.|.....|.:::.::           ..|..|:|          :..|.:..::..
  Fly   243 MDLECHIEAYPPPAIVWTKDDIQL-----------ANNQHYSISHFATADEYTDSTLRVITVEKR 296

  Fly   383 DFGGYKCISKNSIGDTEGTIRLYE 406
            .:|.|.|.:.|..|:.|..:.|:|
  Fly   297 QYGDYVCKATNRFGEAEARVNLFE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 31/120 (26%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 2/6 (33%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 211..307 CDD:472250 26/95 (27%)
Ig strand B 230..234 CDD:409353 0/3 (0%)
Ig strand C 243..247 CDD:409353 2/3 (67%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 17/87 (20%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 4/20 (20%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 1/2 (50%)
LacNP_523713.2 IG_like 36..131 CDD:214653 24/95 (25%)
Ig strand B 46..50 CDD:409381 1/3 (33%)
Ig strand C 60..63 CDD:409381 1/2 (50%)
Ig strand E 96..100 CDD:409381 1/3 (33%)
Ig strand F 110..115 CDD:409381 2/4 (50%)
Ig strand G 124..127 CDD:409381 1/2 (50%)
Ig_3 134..208 CDD:464046 23/81 (28%)
Ig 227..318 CDD:472250 20/101 (20%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 1/3 (33%)
Ig strand F 300..305 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.