DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and DIP-eta

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_608946.3 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:456 Identity:181/456 - (39%)
Similarity:246/456 - (53%) Gaps:58/456 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LLLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSA 136
            |||:|:...|....|  ::.:....:|.|..|:.|:|...||||..||||.:||           
  Fly    19 LLLILMSQQCYPQRV--EVPAEVIVDPKFSSPIVNMTAPVGRDAFLTCVVQDLG----------- 70

  Fly   137 PAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQ 201
            |.||||::.|.:.||.|..||||.|.|:.:.::::.|||:.|:.:|..|.|.||||:||||||.|
  Fly    71 PYKVAWLRVDTQTILTIQNHVITKNQRIGIANSEHKTWTMRIKDIKESDKGWYMCQINTDPMKSQ 135

  Fly   202 TATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKA 266
            ...|:||:||||::..||.||:|.||.:..|.|.|.|.|:|.||||||.|..|....|.    :.
  Fly   136 MGYLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATGSPEPTITWRRESGVPIELATGE----EV 196

  Fly   267 QSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLI 331
            .|:||..|.:..:.|..||||:|||||||||:||||:.|.|||.|::.|.|||:||.....|||.
  Fly   197 MSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLD 261

  Fly   332 CNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIG 396
            |..||.||:||||.||.||::..|.:|:....|...|...|.|||..|..::||.|:|::|||:|
  Fly   262 CESEAYPKSINYWTRERGEIVPPGGKYSANVTEIGGYRNSMRLHINPLTQAEFGSYRCVAKNSLG 326

  Fly   397 DTEGTIRLY-------------EMERPGKKILRDDDLNEVSKNEVVQKDTRSEDGSRNLNGRLYK 448
            ||:|||:||             |....|||..:..:.:..::.:....:.....|.|..:..|  
  Fly   327 DTDGTIKLYRIPPNAVNYVENFEARHKGKKRTKSSESHHPARAQEHSGEDMENPGKRKADLSL-- 389

  Fly   449 DRAPDQHPASGSDQLLGR---GTMRL--IGTFLLALLVLFTA----LAEAG----------PTTL 494
                   .|...|.:.|.   |:.|.  :|..||.||.:..|    ||.||          |.||
  Fly   390 -------GAESIDSIYGNSAAGSRRRQDLGGVLLLLLPVAVAVAMSLATAGVMRETQMTLPPQTL 447

  Fly   495 S 495
            :
  Fly   448 T 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 50/110 (45%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 3/3 (100%)
Ig strand E 174..178 CDD:409353 2/3 (67%)
Ig strand F 188..193 CDD:409353 3/4 (75%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 48/95 (51%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 2/3 (67%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 3/4 (75%)
Ig strand G 300..303 CDD:409353 2/2 (100%)
IG_like 327..405 CDD:214653 38/77 (49%)
Ig strand B 328..332 CDD:409353 3/3 (100%)
Ig strand C 341..346 CDD:409353 4/4 (100%)
Ig strand E 365..376 CDD:409353 3/10 (30%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 1/2 (50%)
DIP-etaNP_608946.3 IG_like 51..137 CDD:214653 45/96 (47%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 3/3 (100%)
Ig strand E 108..112 CDD:409353 2/3 (67%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
IgI_1_MuSK 145..237 CDD:409562 48/95 (51%)
Ig strand A 145..148 CDD:409562 2/2 (100%)
Ig strand A' 153..158 CDD:409562 3/4 (75%)
Ig strand B 164..171 CDD:409562 2/6 (33%)
Ig strand C 177..182 CDD:409562 3/4 (75%)
Ig strand C' 184..186 CDD:409562 0/1 (0%)
Ig strand D 194..197 CDD:409562 0/6 (0%)
Ig strand E 202..208 CDD:409562 1/5 (20%)
Ig strand F 215..222 CDD:409562 5/6 (83%)
Ig strand G 229..237 CDD:409562 5/7 (71%)
IG_like 252..335 CDD:214653 39/82 (48%)
Ig strand B 258..262 CDD:409353 3/3 (100%)
Ig strand C 271..282 CDD:409353 8/10 (80%)
Ig strand E 301..306 CDD:409353 2/4 (50%)
Ig strand F 316..321 CDD:409353 2/4 (50%)
Ig strand G 329..332 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.