DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and bdl

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:554 Identity:116/554 - (20%)
Similarity:195/554 - (35%) Gaps:158/554 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SGSGLVGLGTGTGTGSGCGPAIRWQLLLLLLLG-NCIDLTVSNKISSVGAFEPDFVIPLENVTIA 110
            |||.|:.|                 |.::||:. :|......::..:             |:...
  Fly    12 SGSALLAL-----------------LAIILLMNISCTSAARDHRRQT-------------NLEAK 46

  Fly   111 QGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITN----NDRLSV--QHN 169
            .|....|.|.::       ....:..|..|.|.| |.|.|...:|...:.    |.||.:  .|.
  Fly    47 VGSHVVFNCYID-------FPFDAPIPYLVHWTK-DNKKIFTWYEQETSTSELFNGRLHLVENHP 103

  Fly   170 DYNTWTLNIRGVKMEDAGKYMCQV---NTDP----------MKMQTATLEVVIPPDIINEETSGD 221
            ::...::|:..::..|.|.|.|||   |..|          :.:|..:| :.|||  :|:     
  Fly   104 EFGRASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSL-IRIPP--VNQ----- 160

  Fly   222 MMVPEGGSAKLVCRARGHPK-PKITWRREDG------REIIAR-----NGSHQKTKAQSVEGEML 274
             .:.||.:|...|..: ||: .:.:|.: ||      ::::.|     :||             |
  Fly   161 -TIREGQTAFFHCVMK-HPENSQASWYK-DGVLLQEVQDLVRRFYMGPDGS-------------L 209

  Fly   275 TLSKITRSEMGAYMCIA--SNGVPPTVSKRMKLQ-----VHFHPLVQVPNQLVGAPVLTDVTLIC 332
            ::.....|::|.|.|..  |:|...|....:.:|     ::..|.|.:|   .|.|.:.|    |
  Fly   210 SIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLP---YGQPAVLD----C 267

  Fly   333 NVEASPKAINY-WQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIG 396
            :..|:|...|. |:::.    :..|.|.:   ....|.:...|...::..:..|.|.|...|.:|
  Fly   268 HFRANPPLKNLRWEKDG----LLFDSYNV---PGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLG 325

  Fly   397 DTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQK---------DTRSEDGSRN---LNGRLYKD 449
             |:|...:..:     .:||....:...|...:||         :....||:..   :.||  ||
  Fly   326 -TDGPSPVISV-----IVLRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGR--KD 382

  Fly   450 RAP---DQHPASGSDQLL------GRGTMRLIGTFLLALLVLFTALAEAGPTTLSCRTKGGRQKK 505
            ..|   |:...||.:..:      .||......|...|.:   ||.||.....::.|........
  Fly   383 GQPLPADRFSLSGGNLTITGLVEGDRGIYECSATNEAATI---TAEAELMIENIAPRAPYNLTAN 444

  Fly   506 AKET----SWNGRRARDGREDG------HAAEWR 529
            :.||    .|.....|...|..      .|.|||
  Fly   445 STETCITIRWQPGYLRPNLEYTVWYRLMEAPEWR 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 27/129 (21%)
ig 102..195 CDD:278476 23/101 (23%)
IG_like 219..307 CDD:214653 21/106 (20%)
Ig 221..307 CDD:299845 21/104 (20%)
Ig 311..404 CDD:299845 22/93 (24%)
IG_like 327..405 CDD:214653 17/78 (22%)
bdlNP_608822.1 IG_like 42..128 CDD:214653 22/93 (24%)
Ig 43..131 CDD:299845 22/95 (23%)
I-set 153..242 CDD:254352 24/111 (22%)
Ig 157..242 CDD:299845 22/107 (21%)
Ig_2 252..337 CDD:290606 22/104 (21%)
IG_like 260..327 CDD:214653 17/78 (22%)
I-set 341..428 CDD:254352 20/91 (22%)
IGc2 356..419 CDD:197706 13/64 (20%)
FN3 435..524 CDD:238020 10/44 (23%)
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.