DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr2

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:236 Identity:67/236 - (28%)
Similarity:97/236 - (41%) Gaps:52/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 DFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDR 163
            ||.:| .|:|...|..|...|.|:|||...||           ||:.....||.......|:::|
  Fly   109 DFGMP-RNITTRTGHTAAINCRVDNLGDKSVS-----------WIRKRDLHILTAGILTYTSDER 161

  Fly   164 LSVQHN-DYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVI-PPD---IINEETSGDMM 223
            ..|... |...|||:::..:..|:|.|.|||||:|.......|.|:: |||   ||...|  |:.
  Fly   162 FKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPT--DLY 224

  Fly   224 VPEGGSAKLVCRARGHPKPKIT---------WRREDGREIIARNGSH--------QKTKAQSVEG 271
            |..|.|..|.|    |.|...|         |.|  |..|:....:|        |:...:|...
  Fly   225 VKVGSSVTLTC----HVKQPATSAQDIGPIYWYR--GPYILTPFVAHPNDAAIDLQRISMESTLA 283

  Fly   272 EML-TLSKITRSEM---GAYMCIASNGVPPTVSKRMKLQVH 308
            |.| :..:|..:::   |.|.|:      ||.::...:.|:
  Fly   284 EKLQSRLRIANAQLLDTGNYTCM------PTTAEAASVVVN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 36/110 (33%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 3/3 (100%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 29/119 (24%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/12 (8%)
Ig strand E 272..276 CDD:409353 2/4 (50%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653
Ig strand B 328..332 CDD:409353
Ig strand C 341..346 CDD:409353
Ig strand E 365..376 CDD:409353
Ig strand F 386..391 CDD:409353
Ig strand G 399..402 CDD:409353
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 33/104 (32%)
Ig strand A' 116..118 CDD:409355 0/1 (0%)
Ig strand B 122..130 CDD:409355 2/7 (29%)
CDR1 130..136 CDD:409355 4/5 (80%)
FR2 137..151 CDD:409355 6/24 (25%)
Ig strand C 137..143 CDD:409355 4/16 (25%)
Ig strand C' 149..153 CDD:409355 1/3 (33%)
CDR2 153..162 CDD:409355 1/8 (13%)
Ig strand D 162..167 CDD:409355 1/4 (25%)
FR3 163..192 CDD:409355 9/28 (32%)
Ig strand E 172..178 CDD:409355 3/5 (60%)
Ig strand F 186..192 CDD:409355 3/5 (60%)
IG_like 220..306 CDD:214653 22/93 (24%)
Ig strand B 231..235 CDD:409353 1/3 (33%)
Ig strand C 261..265 CDD:409353 0/3 (0%)
Ig strand E 289..292 CDD:409353 0/2 (0%)
Ig strand F 302..307 CDD:409353 2/10 (20%)
Ig strand G 310..313 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.