DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr3

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:258 Identity:66/258 - (25%)
Similarity:98/258 - (37%) Gaps:68/258 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 DFVIPLENVTIAQGR-DATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNND 162
            ||.:| .|:|...|. :|...|.|::|  |..|         |:||:.....||.:.....|::.
  Fly   239 DFGMP-RNITGRTGHTEAIIKCRVDSL--HDKS---------VSWIRKRDLHILTVGTATYTSDK 291

  Fly   163 RLSV-QHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVV-IPPDIINEETSG--DMM 223
            |..| :..|...|||:::....:|:|.|.|||||:|.......|.:: |.|| .....||  |:.
  Fly   292 RFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPD-AKAVISGPPDLH 355

  Fly   224 VPEGGSAKLVCRARGHPKPK----ITWRR----------EDGR-EIIARNGSH-----QKTKAQS 268
            ...|.:..|.|..: .|..|    |.|.|          :||: ||.|..|.|     :.|....
  Fly   356 FKAGSAIILNCLVQ-QPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPND 419

  Fly   269 VEGEM-----------------------LTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVH 308
            :..|:                       |.:|....::.|.|.|      .||.:....:.||
  Fly   420 IMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTC------QPTTASSASVLVH 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 34/112 (30%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 1/3 (33%)
Ig strand E 174..178 CDD:409353 3/3 (100%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 29/140 (21%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 2/7 (29%)
Ig strand E 272..276 CDD:409353 2/26 (8%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653
Ig strand B 328..332 CDD:409353
Ig strand C 341..346 CDD:409353
Ig strand E 365..376 CDD:409353
Ig strand F 386..391 CDD:409353
Ig strand G 399..402 CDD:409353
dpr3NP_001014459.2 IG_like 243..329 CDD:214653 31/97 (32%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 269..272 CDD:409353 1/2 (50%)
Ig strand E 304..308 CDD:409353 3/3 (100%)
Ig strand F 318..323 CDD:409353 2/4 (50%)
IG_like <441..477 CDD:214653 9/42 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.