DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and CG33543

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:273 Identity:63/273 - (23%)
Similarity:106/273 - (38%) Gaps:44/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 RLSVQHNDYNTWTLNIRGVKMEDAGKYMCQV--------NTDPMKMQTATLEVVIPPDIINEETS 219
            |:.::........|....:.:||.|.:.|:|        |.:..:...|:.|:::...|...:|.
  Fly    94 RVHIEKKTTGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISFGKTE 158

  Fly   220 GDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEM---LTLSKITR 281
            ....|.||..|.:.|...|.|.|:::|         ..||.:..|...:....:   |.:..:::
  Fly   159 QVQSVREGRDAMVNCFVEGMPAPEVSW---------LYNGEYINTVNSTKHNRLSNGLYIRNVSQ 214

  Fly   282 SEMGAYMCIASNGVPP-------TVSKRMKLQVH--FHPLVQVPNQLVGAPVLTDVTLICNVEAS 337
            ::.|.|.|.|....|.       |:..|::.:.|  |:..:.|....||..    |.|.|:....
  Fly   215 ADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNETLPVQYAYVGGA----VNLSCDAMGE 275

  Fly   338 PKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTI 402
            |.....|...|..::....|..:.:     |...:.|.:|  .:|.||.|||...|.:|..|..|
  Fly   276 PPPSFTWLHNNKGIVGFNHRIFVAD-----YGATLQLQMK--NASQFGDYKCKVANPLGMLERVI 333

  Fly   403 RLYEMERPGKKIL 415
            :|    |||.|.|
  Fly   334 KL----RPGPKPL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 10/53 (19%)
ig 102..195 CDD:278476 7/39 (18%)
IG_like 219..307 CDD:214653 20/97 (21%)
Ig 221..307 CDD:299845 20/95 (21%)
Ig 311..404 CDD:299845 23/92 (25%)
IG_like 327..405 CDD:214653 20/77 (26%)
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 15/67 (22%)
IG_like 256..336 CDD:214653 24/94 (26%)
IGc2 263..327 CDD:197706 18/74 (24%)
FN3 341..445 CDD:238020 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442809
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.