DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and musk

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001004503.1 Gene:musk / 334526 ZFINID:ZDB-GENE-030131-6458 Length:941 Species:Danio rerio


Alignment Length:313 Identity:73/313 - (23%)
Similarity:128/313 - (40%) Gaps:52/313 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNND 162
            |.....||.|..:...:|||.|.|:           |...|.:.|.:.:.........:||..|.
Zfish    26 PRITTLLETVDSSLDHNATFICEVD-----------SYPQADIIWTRNNYPIRYYDSRYVIQENG 79

  Fly   163 RLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQT-ATLEVVIPPDIINEETSGDMMVPE 226
            ::           |.|..||..|:|:|.|..|....:.:: ..|::.:.|.|....|:..:::. 
Zfish    80 QM-----------LIIPNVKDSDSGEYCCIANNGVGEAKSCGALQLKMKPQIKRHPTNMTLILE- 132

  Fly   227 GGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIA 291
             ..|.|.|.:.|:|||:|:|.:||  ::|..|     .:...:|...|.::.|.:.:.|.|.|:|
Zfish   133 -SKAVLPCLSLGYPKPEISWIKED--DLIKAN-----NRIAILESGSLKITNIKKEDAGQYRCVA 189

  Fly   292 SNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAP------VLTDVTLICNVEASPKAINYWQRENGE 350
            .|......|:.:.::      ||.|.:::..|      :.::|||.||...:|.....| .|||.
Zfish   190 RNSFGIAFSRPVTIE------VQAPAKILKVPKEKRVQIGSEVTLECNATGNPIPSITW-LENGN 247

  Fly   351 MIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIR 403
            .|...........|..:..:::::|...|       |.|.:.|.....|.|::
Zfish   248 TISGASVVETLVGEVILSVLQVVVHKPAL-------YTCQATNRHSGGENTVK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 25/111 (23%)
Ig strand B 115..119 CDD:409353 3/3 (100%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/3 (0%)
Ig 211..307 CDD:472250 25/95 (26%)
Ig strand B 230..234 CDD:409353 2/3 (67%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 1/2 (50%)
IG_like 327..405 CDD:214653 19/77 (25%)
Ig strand B 328..332 CDD:409353 3/3 (100%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 0/10 (0%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 1/2 (50%)
muskNP_001004503.1 Ig 32..113 CDD:472250 23/102 (23%)
Ig strand B 43..47 CDD:409353 3/3 (100%)
Ig strand C 56..60 CDD:409353 0/3 (0%)
Ig strand E 80..84 CDD:409353 1/14 (7%)
Ig strand F 94..99 CDD:409353 2/4 (50%)
Ig strand G 107..110 CDD:409353 0/2 (0%)
IgI_2_MuSK 119..206 CDD:409560 24/101 (24%)
Ig strand A 119..122 CDD:409560 1/2 (50%)
Ig strand A' 126..128 CDD:409560 0/1 (0%)
Ig strand B 134..142 CDD:409560 3/7 (43%)
Ig strand C 148..153 CDD:409560 2/4 (50%)
Ig strand C' 155..158 CDD:409560 1/4 (25%)
Ig strand D 163..167 CDD:409560 0/3 (0%)
Ig strand E 170..176 CDD:409560 1/5 (20%)
Ig strand F 183..191 CDD:409560 4/7 (57%)
Ig strand G 194..199 CDD:409560 0/4 (0%)
Ig strand G' 201..206 CDD:409560 0/10 (0%)
Ig 212..300 CDD:472250 20/90 (22%)
Ig strand B 226..230 CDD:409353 3/3 (100%)
Ig strand C 239..243 CDD:409353 1/4 (25%)
Ig strand E 260..264 CDD:409353 1/3 (33%)
Ig strand F 276..281 CDD:409353 3/11 (27%)
Ig strand G 293..296 CDD:409353 0/1 (0%)
CRD_TK_ROR_related 309..449 CDD:143578
KR 454..536 CDD:214527
PTKc_Musk 640..930 CDD:133181
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.