DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and HSPG2

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_011539620.1 Gene:HSPG2 / 3339 HGNCID:5273 Length:4574 Species:Homo sapiens


Alignment Length:315 Identity:78/315 - (24%)
Similarity:124/315 - (39%) Gaps:74/315 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 TIAQGRDATFTCVVNNLGGHRVSGDGSSAPA-KVAWIKADAKAILAIHEHVITNNDRLSVQHNDY 171
            ::..|.|.||.|...           |.:|| .:.|.:        :|      |.:|..:..|:
Human  1965 SVRPGADVTFICTAK-----------SKSPAYTLVWTR--------LH------NGKLPTRAMDF 2004

  Fly   172 NTWTLNIRGVKMEDAGKYMCQ-VNTDPMKMQTATLEVVIPPDIINEETSGDMMVP---------- 225
            | ..|.||.|::.|||.|:|. .|...|...||||.|         :.||.:..|          
Human  2005 N-GILTIRNVQLSDAGTYVCTGSNMFAMDQGTATLH
V---------QASGTLSAPVVSIHPPQLT 2059

  Fly   226 --EGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYM 288
              .|..|:..|.|.|.|.|.:.|....|.::.|        ||| :.|.:|.|..:..::...|:
Human  2060 VQPGQLAEFRCSATGSPTPTLEWTGGPGGQLPA--------KAQ-IHGGILRLPAVEPTDQAQYL 2115

  Fly   289 CIASNGVPPTVSKRMKLQVHFH----PLVQVPNQLVGAPVLTDVTLICNVEASPKAINYWQRENG 349
            |.|.:.....|::.:   :|.|    |.|||..:.........|.|.|.....|.|...|::|.|
Human  2116 CRAHSSAGQQVARAV---LHV
HGGGGPRVQVSPERTQVHAGRTVRLYCRAAGVPSATITWRKEGG 2177

  Fly   350 EMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRL 404
            .:    ...|.:|:.:    |..:| |..:.::|.|.|.|::.:..|..:..|::
Human  2178 SL----PPQARSERTD----IATLL-IPAITTADAGFYLCVATSPAGTAQARIQV 2223

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 30/102 (29%)
Ig strand B 115..119 CDD:409353 2/3 (67%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/5 (40%)
Ig strand G 202..205 CDD:409353 2/2 (100%)
Ig 211..307 CDD:472250 23/107 (21%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 0/3 (0%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 19/78 (24%)
Ig strand B 328..332 CDD:409353 2/3 (67%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 2/10 (20%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)
HSPG2XP_011539620.1 Ig strand G 3834..3837 CDD:409353
LamG 3848..4008 CDD:238058
EGF_CA <4035..4064 CDD:238011
EGF_CA <4076..4105 CDD:238011
LamG 4117..4266 CDD:238058
EGF 4291..4321 CDD:394967
EGF_CA 4328..4359 CDD:238011
LamG 4386..4545 CDD:238058
SEA 80..193 CDD:214554
LDLa 216..251 CDD:238060
LDLa 302..336 CDD:238060
LDLa 342..376 CDD:238060
LDLa 385..420 CDD:238060
Ig_Perlecan_like 438..515 CDD:143220
Ig strand B 441..447 CDD:143220
Ig strand C 454..459 CDD:143220
Ig strand E 479..483 CDD:143220
Ig strand F 492..498 CDD:143220
Ig strand G 507..513 CDD:143220
LamB 608..734 CDD:214597
EGF_Lam 782..824 CDD:238012
EGF_Lam 831..888 CDD:238012
Laminin_EGF 897..939 CDD:395007
LamB 1003..1130 CDD:214597
EGF_Lam 1176..1225 CDD:238012
EGF_Lam 1227..1282 CDD:238012
Laminin_EGF 1293..1340 CDD:395007
LamB 1574..1699 CDD:214597
EGF_Lam 1746..1794 CDD:238012
Laminin_EGF 1796..1851 CDD:395007
IG_like 1866..1946 CDD:214653
Ig strand B 1877..1881 CDD:409353
Ig strand C 1890..1895 CDD:409353
Ig strand E 1912..1916 CDD:409353
Ig strand F 1926..1931 CDD:409353
Ig strand G 1939..1942 CDD:409353
IgI_Perlecan_like 1954..2039 CDD:409412 28/99 (28%)
Ig strand A 1954..1958 CDD:409412