DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and CG6867

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster


Alignment Length:270 Identity:85/270 - (31%)
Similarity:129/270 - (47%) Gaps:52/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 KMQ----TATLEVVIPPDIINEETSGDMMVP---------EGGSAKLVCRARGHPKPKITWRRED 250
            |:|    :::.:::|||.|.      |:.||         ||.|..|.|.|.|.|.|::.|||||
  Fly   415 KLQYPNGSSSNDLLIPPSIT------DIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRRED 473

  Fly   251 GREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQV 315
            ||.|.. ||    .:..|:.|:.|..:.|||.:|.||.|.|:||:.|..:....::|.|.|::.|
  Fly   474 GRTINV-NG----VEMASISGQFLRFTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISV 533

  Fly   316 PNQLVGAPVLTDVTLICNVEASPKAINYWQRE-NGEMIIAGDRYALTEKENNMYAIEMILHIKRL 379
            ..|::.|...:..||.|.|||.|:||.||:|. :|:::...|:|.: |.....:...|.|.|..|
  Fly   534 YRQMIYAEYQSSATLECLVEAFPEAIRYWERAYDGKILDPSDKYGI-ESYPEGFKTTMRLTISNL 597

  Fly   380 QSSDFGGYKCISKNSIGDTEGTIRLYEMERPGKKILRDDDLNEVSKN-EVVQKDTRSEDGSRNLN 443
            :..|||.|.|:::|                         :||....| |:..:|..||......|
  Fly   598 RKDDFGYYHCVARN-------------------------ELNATMVNFEIAPQDPNSETPYVGNN 637

  Fly   444 GRLYKDRAPD 453
            .::|..|.|:
  Fly   638 MKVYGQRPPE 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 2/13 (15%)
Ig strand B 115..119 CDD:409353
Ig strand C 139..143 CDD:409353
Ig strand E 174..178 CDD:409353
Ig strand F 188..193 CDD:409353
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 38/104 (37%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 0/3 (0%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 3/4 (75%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 26/78 (33%)
Ig strand B 328..332 CDD:409353 2/3 (67%)
Ig strand C 341..346 CDD:409353 3/4 (75%)
Ig strand E 365..376 CDD:409353 2/10 (20%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)
CG6867NP_573262.2 gly_rich_SclB <257..>409 CDD:468478
Ig 436..525 CDD:472250 35/93 (38%)
Ig strand B 453..457 CDD:409353 1/3 (33%)
Ig strand C 466..470 CDD:409353 0/3 (0%)
Ig strand E 490..494 CDD:409353 1/3 (33%)
Ig strand F 504..509 CDD:409353 3/4 (75%)
Ig strand G 518..521 CDD:409353 0/2 (0%)
Ig_3 529..611 CDD:464046 29/82 (35%)
OLF 694..939 CDD:460482
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.