DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr18

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:417 Identity:90/417 - (21%)
Similarity:142/417 - (34%) Gaps:149/417 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PDFVIPLENVTIAQG--------RDATFTCVVNNLGGHRVSGDGSSAPAKVAWIK--ADAKAILA 152
            |.|..|:.:.|....        .:|...|.|           |......|.|::  |:..::|.
  Fly   217 PFFEEPINSATSGDNLVSAVHLFTEAVLNCRV-----------GMLKDKTVMWVRRTAEKVSLLT 270

  Fly   153 IHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPP-DIINE 216
            :.....:.:.|:.|:....|.|.|.|...:.||||.|||||:|.|.::.|..|.|:.|| .||:|
  Fly   271 VGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDE 335

  Fly   217 ETS--GDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKI 279
            ...  ||.....|.:..|.|:                   |:|: ..||        |..|:.|.
  Fly   336 HERDVGDRYYKSGSTVDLQCQ-------------------ISRS-FFQK--------ERQTILKS 372

  Fly   280 TRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNVEASPKAINYW 344
            |.|        |::.|...:::                      ..:::.||.||       |..
  Fly   373 TDS--------ANDAVQKLINE----------------------TTSELNLIGNV-------NQT 400

  Fly   345 QRE-NGE---------MIIAGDRYALTEKENNMYAIEMILHIKRL-----QSSDFGGYKCISKNS 394
            |.: :|:         :..|.|...|....|...::..:....|:     :.||.|.|.|    |
  Fly   401 QHKFSGQDLEKYFTKFITWAKDEEPLQGMTNRRLSVSDVWLTSRISIGDAKLSDSGNYSC----S 461

  Fly   395 IGDTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQKDTRSEDGSRNLNGRLYKDRAPDQHPASG 459
            :|      ||:.:                    :||...        |.|.|   .|..||....
  Fly   462 LG------RLFTV--------------------IVQVQV--------LTGEL---PAAVQHNIGS 489

  Fly   460 SDQLLGRGTMRLIGTFLLALLVLFTAL 486
            ..::.   ::.::| .||.|:.|||.|
  Fly   490 RTEIY---SLAMLG-HLLVLIFLFTCL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 32/120 (27%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 1/3 (33%)
Ig strand E 174..178 CDD:409353 2/3 (67%)
Ig strand F 188..193 CDD:409353 3/4 (75%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 211..307 CDD:472250 20/98 (20%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 0/3 (0%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 0/4 (0%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 20/92 (22%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 1/10 (10%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 27/93 (29%)
Ig strand B 242..246 CDD:409433 1/3 (33%)
Ig strand C 255..264 CDD:409433 2/8 (25%)
Ig strand E 292..296 CDD:409433 2/3 (67%)
Ig strand F 306..311 CDD:409433 3/4 (75%)
Ig <417..474 CDD:472250 16/86 (19%)

Return to query results.
Submit another query.