DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr8

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:319 Identity:83/319 - (26%)
Similarity:120/319 - (37%) Gaps:80/319 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 WQLLL--LLLLGNCIDLTVSNKISSVGA---FEPDFVIPL---------------ENVTIAQGRD 114
            |.:.|  |.||..|.|          ||   |..||:..|               .|:|...|:.
  Fly     5 WIIFLGILCLLAGCTD----------GASKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKT 59

  Fly   115 ATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDY-NTWTLNI 178
            ...||.|.|||...||           |::.....:|.:..:..|::.|....|:.: ..|||.|
  Fly    60 VKLTCRVKNLGNRTVS-----------WVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRI 113

  Fly   179 RGVKMEDAGKYMCQVNTDPMKMQTATLEVVIP-PDIINEETSGDMMVPEGGSAKLVCRARGHPKP 242
            |..:.:|:|.|.||::|.|....:..|.:|.| .|||.   ..::.:..|.:..|.|..:..|:|
  Fly   114 RYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIG---GPELHINRGSTINLTCIVKFAPEP 175

  Fly   243 KITWRREDGREII----ARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRM 303
            ..|......||||    .|.|....|:...:....|.:.|....:.|.|.|..||..|.:|    
  Fly   176 PPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSV---- 236

  Fly   304 KLQVHF----HP-----------LVQVPNQLVGAPVLTDVTLI-------CN--VEASP 338
              :||.    ||           ....|..|:...:||..||:       |:  |.|:|
  Fly   237 --RVHIVDGEHPAAMHTGNNGNSTASQPPVLLPLVLLTCSTLMLLQLVASCSTLVPATP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 32/126 (25%)
Ig strand B 115..119 CDD:409353 0/3 (0%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 3/3 (100%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 25/99 (25%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 6/21 (29%)
Ig strand B 328..332 CDD:409353 2/10 (20%)
Ig strand C 341..346 CDD:409353
Ig strand E 365..376 CDD:409353
Ig strand F 386..391 CDD:409353
Ig strand G 399..402 CDD:409353
dpr8NP_727781.1 IG_like 51..131 CDD:214653 26/90 (29%)
Ig strand B 60..64 CDD:409353 0/3 (0%)
Ig strand C 73..77 CDD:409353 2/14 (14%)
Ig strand E 109..113 CDD:409353 3/3 (100%)
Ig strand F 123..128 CDD:409353 2/4 (50%)
Ig_3 153..230 CDD:464046 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.