DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Skint4

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_848901.2 Gene:Skint4 / 320640 MGIID:2444425 Length:482 Species:Mus musculus


Alignment Length:210 Identity:49/210 - (23%)
Similarity:85/210 - (40%) Gaps:51/210 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 GGSAKLVCRARGHPKP----KITWRREDGREII--ARNGS--HQKTKAQSVE-GEMLT------- 275
            ||:.:|.|:. ..|:.    :|.|.|....:.:  .|||.  |.:|.::.|| .|:||       
Mouse    49 GGNVELNCQL-SPPQQAQHMEIRWFRNRYTQPVHLYRNGKNLHGETMSKYVERTELLTDAFNEGK 112

  Fly   276 ----LSKITRSEMGAYMCIASNG-----------VPPTVSKRMKLQVHFHPLVQVPNQLVGAPVL 325
                :..:|..:.|||.|:..:|           |..|.|   .:|:..|           .|.:
Mouse   113 VILRILNVTVDDGGAYHCVFKDGEFYEEHITEVKVT
ATSS---DIQILMH-----------TPNI 163

  Fly   326 TDVTLICNVEA-SPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKC 389
            ..|.|.|:... .|:....|:...||:|.|..::...:| |.::.:.|:|.|   ::|......|
Mouse   164 KGVMLECHSGGWFPQPHMEWRNSKGEVIQATSKFHSQDK-NKLFNMSMVLFI---EASSHRNVIC 224

  Fly   390 ISKNSIGDTEGTIRL 404
            ..:|.:...|.:|.:
Mouse   225 YFQNLVTHQEQSINI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352
ig 102..195 CDD:278476
IG_like 219..307 CDD:214653 27/110 (25%)
Ig 221..307 CDD:299845 27/110 (25%)
Ig 311..404 CDD:299845 20/93 (22%)
IG_like 327..405 CDD:214653 19/79 (24%)
Skint4NP_848901.2 IG_like 41..147 CDD:214653 24/98 (24%)
Ig_MOG_like 49..148 CDD:143190 24/99 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.