DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and CG15312

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster


Alignment Length:75 Identity:21/75 - (28%)
Similarity:36/75 - (48%) Gaps:15/75 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 EGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCI 290
            :||:..:.|.|:|:    |.|.:|.|         :..|..|:  |.:|.|..::.::.|.|:|.
  Fly    39 KGGNVSIPCIAQGN----IMWVKEHG---------NNSTIVQT--GRVLVLRNVSTTDAGIYVCF 88

  Fly   291 ASNGVPPTVS 300
            ||...|.|.:
  Fly    89 ASVPRPSTTA 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250
Ig strand B 115..119 CDD:409353
Ig strand C 139..143 CDD:409353
Ig strand E 174..178 CDD:409353
Ig strand F 188..193 CDD:409353
Ig strand G 202..205 CDD:409353
Ig 211..307 CDD:472250 21/75 (28%)
Ig strand B 230..234 CDD:409353 0/3 (0%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/1 (0%)
IG_like 327..405 CDD:214653
Ig strand B 328..332 CDD:409353
Ig strand C 341..346 CDD:409353
Ig strand E 365..376 CDD:409353
Ig strand F 386..391 CDD:409353
Ig strand G 399..402 CDD:409353
CG15312NP_001245603.1 Ig 39..90 CDD:472250 17/65 (26%)
Ig strand B 43..47 CDD:409358 0/3 (0%)
Ig strand C 52..56 CDD:409358 1/7 (14%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.