| Sequence 1: | NP_001138225.1 | Gene: | DIP-beta / 33125 | FlyBaseID: | FBgn0259245 | Length: | 555 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001245581.1 | Gene: | Nrg / 31792 | FlyBaseID: | FBgn0264975 | Length: | 1309 | Species: | Drosophila melanogaster |
| Alignment Length: | 305 | Identity: | 77/305 - (25%) |
|---|---|---|---|
| Similarity: | 120/305 - (39%) | Gaps: | 82/305 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 133 GSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDP 197
Fly 198 MKMQTAT--LEVVIPPDIINEETSGDMMVPEGGSAK------LVCRARGHPKPKITWRREDGREI 254
Fly 255 IARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGV--------------PPTVSKRMKL 305
Fly 306 QVHFHPLVQVPNQLVGAPVLT----DVTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENN 366
Fly 367 MYAIEMILHIKRLQSSDFGGYKCISKNSIGD--TEGTIRLYEMER 409 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-beta | NP_001138225.1 | Ig | 98..209 | CDD:472250 | 22/77 (29%) |
| Ig strand B | 115..119 | CDD:409353 | |||
| Ig strand C | 139..143 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 174..178 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 188..193 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 202..205 | CDD:409353 | 0/4 (0%) | ||
| Ig | 211..307 | CDD:472250 | 27/115 (23%) | ||
| Ig strand B | 230..234 | CDD:409353 | 1/9 (11%) | ||
| Ig strand C | 243..247 | CDD:409353 | 2/3 (67%) | ||
| Ig strand E | 272..276 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 286..291 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 300..303 | CDD:409353 | 1/2 (50%) | ||
| IG_like | 327..405 | CDD:214653 | 22/79 (28%) | ||
| Ig strand B | 328..332 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 341..346 | CDD:409353 | 1/4 (25%) | ||
| Ig strand E | 365..376 | CDD:409353 | 1/10 (10%) | ||
| Ig strand F | 386..391 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 399..402 | CDD:409353 | 1/2 (50%) | ||
| Nrg | NP_001245581.1 | Ig | 29..128 | CDD:472250 | |
| Ig strand B | 55..59 | CDD:409353 | |||
| Ig strand C | 68..72 | CDD:409353 | |||
| Ig strand E | 94..98 | CDD:409353 | |||
| Ig strand F | 108..113 | CDD:409353 | |||
| Ig strand G | 122..125 | CDD:409353 | |||
| Ig | 137..216 | CDD:472250 | |||
| Ig strand B | 151..155 | CDD:409353 | |||
| Ig strand C | 165..169 | CDD:409353 | |||
| Ig strand E | 192..196 | CDD:409353 | |||
| Ig strand F | 209..214 | CDD:409353 | |||
| ig | 251..332 | CDD:395002 | 20/72 (28%) | ||
| Ig strand B | 264..268 | CDD:409353 | |||
| Ig strand C | 277..281 | CDD:409353 | 1/4 (25%) | ||
| Ig strand E | 305..309 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 314..319 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 328..331 | CDD:409353 | 0/2 (0%) | ||
| IgI_4_hemolin-like | 339..427 | CDD:409570 | 23/100 (23%) | ||
| Ig strand A | 339..342 | CDD:409570 | 1/2 (50%) | ||
| Ig strand A' | 348..351 | CDD:409570 | 0/2 (0%) | ||
| Ig strand B | 356..363 | CDD:409570 | 2/6 (33%) | ||
| Ig strand C | 369..374 | CDD:409570 | 3/5 (60%) | ||
| Ig strand C' | 377..379 | CDD:409570 | 0/1 (0%) | ||
| Ig strand D | 387..391 | CDD:409570 | 1/7 (14%) | ||
| Ig strand E | 393..397 | CDD:409570 | 0/3 (0%) | ||
| Ig strand F | 406..414 | CDD:409570 | 4/7 (57%) | ||
| Ig strand G | 417..427 | CDD:409570 | 0/9 (0%) | ||
| Ig | 446..517 | CDD:472250 | 22/80 (28%) | ||
| Ig strand B | 449..453 | CDD:409358 | 2/3 (67%) | ||
| Ig strand C | 462..466 | CDD:409358 | 0/3 (0%) | ||
| Ig strand E | 483..487 | CDD:409358 | 1/11 (9%) | ||
| Ig strand F | 497..502 | CDD:409358 | 2/4 (50%) | ||
| Ig strand G | 510..513 | CDD:409358 | 0/2 (0%) | ||
| Ig | 521..615 | CDD:472250 | 1/2 (50%) | ||
| Ig strand B | 538..542 | CDD:409353 | |||
| Ig strand C | 553..557 | CDD:409353 | |||
| Ig strand E | 577..581 | CDD:409353 | |||
| Ig strand F | 591..596 | CDD:409353 | |||
| Ig strand G | 604..607 | CDD:409353 | |||
| FN3 | 613..707 | CDD:238020 | |||
| FN3 | 683..>1051 | CDD:442628 | |||
| fn3 | 817..905 | CDD:394996 | |||
| fn3 | 918..1007 | CDD:394996 | |||
| FN3 | 1041..1111 | CDD:238020 | |||
| Bravo_FIGEY | 1155..>1221 | CDD:464016 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||