DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr14

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:221 Identity:57/221 - (25%)
Similarity:92/221 - (41%) Gaps:37/221 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PDFVIPLE--NVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWI--KADAKAILAIHEHVI 158
            |.|..|..  |::..........|.||:|.|..||           |:  :.|...::...:|..
  Fly    73 PFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVS-----------WMRRRGDDLTLITFGQHTY 126

  Fly   159 TNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIP-PDIINEETSGDM 222
            :.:.|.|::..:.|.|.|.|:.....|.|.|.|||::.|..:....|.:::| .:|::|..|.  
  Fly   127 SGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSA-- 189

  Fly   223 MVPE-----GGSAKLVC--RARGHPKPKITWRREDGREII----ARNGSHQKTKAQSVEGEMLT- 275
             .||     |.:.:|.|  ....||...||||.  |..::    :|.|...||  ..:.|..|: 
  Fly   190 -TPEKYYKAGSTIELQCVISKIPHPSSYITWRH--GPRLLNYDTSRGGISVKT--DMLPGRALSR 249

  Fly   276 --LSKITRSEMGAYMCIASNGVPPTV 299
              ::...|.:.|.|.|:..|.:..||
  Fly   250 LYIANANRQDTGNYTCMLGNEITETV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 28/114 (25%)
Ig strand B 115..119 CDD:409353 0/3 (0%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 2/3 (67%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 28/103 (27%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 2/3 (67%)
Ig strand E 272..276 CDD:409353 1/6 (17%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 57/221 (26%)
IG_like 327..405 CDD:214653
Ig strand B 328..332 CDD:409353
Ig strand C 341..346 CDD:409353
Ig strand E 365..376 CDD:409353
Ig strand F 386..391 CDD:409353
Ig strand G 399..402 CDD:409353
dpr14NP_572419.1 Ig 81..175 CDD:472250 25/104 (24%)
Ig strand B 92..96 CDD:409353 0/3 (0%)
Ig strand C 105..109 CDD:409353 2/14 (14%)
Ig strand E 142..146 CDD:409353 2/3 (67%)
Ig strand F 156..161 CDD:409353 2/4 (50%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 25/89 (28%)
Ig strand B 201..205 CDD:409473 1/3 (33%)
Ig strand C 214..220 CDD:409473 2/5 (40%)
Ig strand E 248..252 CDD:409473 0/3 (0%)
Ig strand F 262..267 CDD:409473 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.