DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Cd276

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_877976.1 Gene:Cd276 / 315716 RGDID:727815 Length:316 Species:Rattus norvegicus


Alignment Length:301 Identity:65/301 - (21%)
Similarity:105/301 - (34%) Gaps:86/301 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GSGLVGLGTGTGTGSGCGPAIRWQLLLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQG 112
            |...||:..||..|           :|.|.|...:::.||.          |.|:.|.:.     
  Rat     6 GGPSVGVSMGTALG-----------VLCLCLTGAVEVQVSE----------DPVVALVDT----- 44

  Fly   113 RDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVIT-NNDR------------- 163
             |||..|..:...|.      |.....:.|...|.|.::    |..| ..|:             
  Rat    45 -DATLRCSFSPEPGF------SLRQLNLIWQLTDTKQLV----HSFTEGRDQGSAYANRTALFPD 98

  Fly   164 LSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIP---PDIINEETS----GD 221
            |.||.|.    :|.::.|::.|.|.|.|.|:.........:|:|..|   |.:..|...    ||
  Rat    99 LLVQGNA----SLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGD 159

  Fly   222 MMVPEGGSAKLVCRA-RGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMG 285
            |:.       :.|.: :|:|:.::.|:...|..:.    .:..|...:.|..:..:..:.|..:|
  Rat   160 MVT-------ITCSSYQGYPEAEVFWKDGQGLPLT----GNVTTSQMANERGLFDVHSVLRVVLG 213

  Fly   286 A---YMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAP 323
            |   |.|:..|.|         ||...|..|.:..|.:..|
  Rat   214 ANGTYSCLVRNPV---------LQQDAHGSVTITGQPMTFP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 28/124 (23%)
ig 102..195 CDD:278476 24/106 (23%)
IG_like 219..307 CDD:214653 18/95 (19%)
Ig 221..307 CDD:299845 17/89 (19%)
Ig 311..404 CDD:299845 3/13 (23%)
IG_like 327..405 CDD:214653
Cd276NP_877976.1 IG_like 37..138 CDD:214653 26/120 (22%)
Ig 44..139 CDD:299845 24/114 (21%)
ig 151..231 CDD:278476 19/99 (19%)
IG_like 156..238 CDD:214653 21/101 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..316
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.