DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Igsf9b

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001363879.1 Gene:Igsf9b / 315510 RGDID:1564717 Length:1441 Species:Rattus norvegicus


Alignment Length:531 Identity:128/531 - (24%)
Similarity:189/531 - (35%) Gaps:167/531 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIH-----EH 156
            ||:|      ||...|......|.|.    |.|:  |...|..|.|.|......:.|.     .|
  Rat    29 EPEF------VTARAGEGVVLRCDVI----HPVT--GQPPPYVVEWFKFGVPIPIFIKFGYYPPH 81

  Fly   157 VITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQV--------------------NTDPMKMQ 201
            |   :...:.:.:.::..:|.:..|:.||.|.|.|:|                    |..|...:
  Rat    82 V---DPEYAGRASLHDKASLRLEQVRSEDQGWYECKVLMLDQQYDTFHNGSWVHLTINAPPTFTE 143

  Fly   202 TATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKA 266
            |       ||..|..:        ||||..:.|.|.|:|||.:||.:|.  .:::.:|.:|    
  Rat   144 T-------PPQYIEAK--------EGGSITMTCTAFGNPKPIVTWLKEG--TLLSASGKYQ---- 187

  Fly   267 QSVEGEMLTLSKITRSEMGAYMC----IASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAP---- 323
              |....||::.::|.:.|||.|    |....|..|           |.|||.|..:|..|    
  Rat   188 --VSDGSLTVTSVSREDRGAYTCRAYSIQGEAVHTT-----------HLLVQGPPFIVSPPENIT 239

  Fly   324 --VLTDVTLICNVEASPKAIN---YWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSD 383
              :..|..|.|..||.|..:.   |||.||  :....|.     |......|:..|.|.|::..|
  Rat   240 VNISQDALLTCRAEAYPGNLTYTWYWQDEN--VYFQNDL-----KLRVRILIDGTLIIFRVKPED 297

  Fly   384 FGGYKCISKNSIGDT----------------------------EGTIRLYEMERPGKKILRDDDL 420
            .|.|.|:..||:|.:                            .|.||......|...:::   .
  Rat   298 AGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATVVK---W 359

  Fly   421 NEVSKNEVVQKD---TRSEDGSRNLNGRLYKDRAPDQHPASGSDQLLGRGTMRLIGTFLLALLVL 482
            |:..:...|:|:   |..||||..:      :.|.::  |.|:...:...|:..:|....|.|||
  Rat   360 NKDGRPLQVEKNLGWTLMEDGSIRI------EEATEE--ALGTYTCVPYNTLGTMGQSAPARLVL 416

  Fly   483 -----FTAL------AEAGPTTL-SCRTKG-----------GRQKKAKETSW-NGR---RARDGR 520
                 ||.|      .|||...| .|...|           |:..::|..:. :|.   ||....
  Rat   417 KDPPYFTVLPGWEYRQEAGRELLIPCAAAGDPFPVITWRKVGKPSRSKHNALPSGSLQFRALSKE 481

  Fly   521 EDGHAAEWRQC 531
            :.|   || :|
  Rat   482 DHG---EW-EC 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 28/135 (21%)
ig 102..195 CDD:278476 23/117 (20%)
IG_like 219..307 CDD:214653 26/91 (29%)
Ig 221..307 CDD:299845 26/89 (29%)
Ig 311..404 CDD:299845 32/129 (25%)
IG_like 327..405 CDD:214653 27/108 (25%)
Igsf9bNP_001363879.1 PHA03247 <898..1246 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..1044
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1111..1332
Ig 41..115 CDD:319273 19/82 (23%)
I-set 139..225 CDD:369462 32/119 (27%)
Ig 229..321 CDD:386229 26/98 (27%)
Ig <353..414 CDD:386229 14/71 (20%)
Ig 438..502 CDD:319273 12/55 (22%)
FN3 510..605 CDD:238020
FN3 621..703 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..821
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.