DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Igsf9b

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001363879.1 Gene:Igsf9b / 315510 RGDID:1564717 Length:1441 Species:Rattus norvegicus


Alignment Length:531 Identity:128/531 - (24%)
Similarity:189/531 - (35%) Gaps:167/531 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIH-----EH 156
            ||:|      ||...|......|.|.    |.|:  |...|..|.|.|......:.|.     .|
  Rat    29 EPEF------VTARAGEGVVLRCDVI----HPVT--GQPPPYVVEWFKFGVPIPIFIKFGYYPPH 81

  Fly   157 VITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQV--------------------NTDPMKMQ 201
            |   :...:.:.:.::..:|.:..|:.||.|.|.|:|                    |..|...:
  Rat    82 V---DPEYAGRASLHDKASLRLEQVRSEDQGWYECKVLMLDQQYDTFHNGSWVHLTINAPPTFTE 143

  Fly   202 TATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKA 266
            |       ||..|..:        ||||..:.|.|.|:|||.:||.:|.  .:::.:|.:|    
  Rat   144 T-------PPQYIEAK--------EGGSITMTCTAFGNPKPIVTWLKEG--TLLSASGKYQ---- 187

  Fly   267 QSVEGEMLTLSKITRSEMGAYMC----IASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAP---- 323
              |....||::.::|.:.|||.|    |....|..|           |.|||.|..:|..|    
  Rat   188 --VSDGSLTVTSVSREDRGAYTCRAYSIQGEAVHTT-----------HLLVQGPPFIVSPPENIT 239

  Fly   324 --VLTDVTLICNVEASPKAIN---YWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSD 383
              :..|..|.|..||.|..:.   |||.||  :....|.     |......|:..|.|.|::..|
  Rat   240 VNISQDALLTCRAEAYPGNLTYTWYWQDEN--VYFQNDL-----KLRVRILIDGTLIIFRVKPED 297

  Fly   384 FGGYKCISKNSIGDT----------------------------EGTIRLYEMERPGKKILRDDDL 420
            .|.|.|:..||:|.:                            .|.||......|...:::   .
  Rat   298 AGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATVVK---W 359

  Fly   421 NEVSKNEVVQKD---TRSEDGSRNLNGRLYKDRAPDQHPASGSDQLLGRGTMRLIGTFLLALLVL 482
            |:..:...|:|:   |..||||..:      :.|.::  |.|:...:...|:..:|....|.|||
  Rat   360 NKDGRPLQVEKNLGWTLMEDGSIRI------EEATEE--ALGTYTCVPYNTLGTMGQSAPARLVL 416

  Fly   483 -----FTAL------AEAGPTTL-SCRTKG-----------GRQKKAKETSW-NGR---RARDGR 520
                 ||.|      .|||...| .|...|           |:..::|..:. :|.   ||....
  Rat   417 KDPPYFTVLPGWEYRQEAGRELLIPCAAAGDPFPVITWRKVGKPSRSKHNALPSGSLQFRALSKE 481

  Fly   521 EDGHAAEWRQC 531
            :.|   || :|
  Rat   482 DHG---EW-EC 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 28/135 (21%)
Ig strand B 115..119 CDD:409353 0/3 (0%)
Ig strand C 139..143 CDD:409353 1/3 (33%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 211..307 CDD:472250 28/99 (28%)
Ig strand B 230..234 CDD:409353 0/3 (0%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 3/8 (38%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 27/108 (25%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 2/7 (29%)
Ig strand E 365..376 CDD:409353 2/10 (20%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 1/2 (50%)
Igsf9bNP_001363879.1 Ig 41..115 CDD:409353 19/82 (23%)
Ig strand B 41..45 CDD:409353 0/3 (0%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
Ig strand E 96..100 CDD:409353 1/3 (33%)
Ig strand F 110..115 CDD:409353 2/4 (50%)
I-set 139..225 CDD:400151 32/119 (27%)
Ig strand B 157..161 CDD:409353 0/3 (0%)
Ig strand C 170..174 CDD:409353 1/3 (33%)
Ig strand E 191..195 CDD:409353 1/3 (33%)
Ig strand F 205..210 CDD:409353 3/4 (75%)
Ig strand G 218..221 CDD:409353 1/2 (50%)
Ig_3 228..307 CDD:464046 24/85 (28%)
Ig 336..410 CDD:472250 17/84 (20%)
Ig strand B 342..346 CDD:409544 2/3 (67%)
Ig strand C 355..360 CDD:409544 0/7 (0%)
Ig strand E 380..384 CDD:409544 2/3 (67%)
Ig strand F 394..399 CDD:409544 0/4 (0%)
Ig strand G 407..410 CDD:409544 1/2 (50%)
Ig 429..505 CDD:472250 15/64 (23%)
Ig strand B 438..442 CDD:409544 1/3 (33%)
Ig strand C 451..455 CDD:409544 0/3 (0%)
Ig strand E 471..475 CDD:409544 1/3 (33%)
Ig strand F 485..490 CDD:409544 3/5 (60%)
FN3 <490..>735 CDD:442628
Ig strand G 498..501 CDD:409544
FN3 510..605 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..821
PHA03247 <898..1246 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..1044
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1111..1332
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.