DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Fas2

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:439 Identity:97/439 - (22%)
Similarity:153/439 - (34%) Gaps:136/439 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHN 169
            ||.....|:|....|        .|..|.:..   :.|::..        :.:.|.||:..||.|
  Fly   145 ENQYPTLGQDYVVMC--------EVKADPNPT---IDWLRNG--------DPIRTTNDKYVVQTN 190

  Fly   170 DYNTWTLNIRGVKMEDAGKYMCQ---VNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAK 231
            .     |.||.|:..|.|.|.|:   :.|..:..:|..:||.|.|:||:..|  ::...||....
  Fly   191 G-----LLIRNVQESDEGIYTCRAAVIETGELLERTIRVEV
FIQPEIISLPT--NLEAVEGKPFA 248

  Fly   232 LVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASN--G 294
            ..|.|||.|.|:|:|.| |..::........:...|:   .::|:|.:::.:.|.|.|:|.|  |
  Fly   249 ANCTARGKPVPEISWIR-DATQLNVATADRFQVNPQT---GLVTISSVSQDDYGTYTCLAKNRAG 309

  Fly   295 VPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNVEASP-KAINY--W---------QRE 347
            |   |.::.||.|...|.:.....:.||.. .::.:.|..:..| .||.:  |         |::
  Fly   310 V---VDQKTKLNV
LVRPQIYELYNVTGART-KEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQD 370

  Fly   348 NGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEMERPGK 412
            :...||....:.....|:.     ..|.|...:.||.|.|:||::|...|...|           
  Fly   371 DDPRIILEPNFDEERGEST-----GTLRISNAERSDDGLYQCIARNKGADAYKT----------- 419

  Fly   413 KILRDDDLNEVSKNEVVQKDTRSEDGSRNLNGRLYKDRAPDQHPASGSDQLLGRGTMRLIGTFLL 477
                                           |.:..:.|||                        
  Fly   420 -------------------------------GHITVEFAPD------------------------ 429

  Fly   478 ALLVLFTALAEAGP--------TTLSCRTKGGRQKKAKETSWNGRRARD 518
                 |:.:.|..|        ..|||... |......|..||||:.:|
  Fly   430 -----FSHMKELPPVFSWEQRKANLSCLAM-GIPNATIEWHWNGRKIKD 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 26/106 (25%)
ig 102..195 CDD:278476 22/92 (24%)
IG_like 219..307 CDD:214653 25/89 (28%)
Ig 221..307 CDD:299845 25/87 (29%)
Ig 311..404 CDD:299845 23/104 (22%)
IG_like 327..405 CDD:214653 20/89 (22%)
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 24/104 (23%)
IGc2 152..209 CDD:197706 20/80 (25%)
I-set 230..319 CDD:254352 29/97 (30%)
IGc2 243..309 CDD:197706 20/69 (29%)
IG_like 330..424 CDD:214653 23/141 (16%)
IGc2 339..412 CDD:197706 17/77 (22%)
Ig 447..518 CDD:143165 10/27 (37%)
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.