DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and DIP-alpha

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:382 Identity:193/382 - (50%)
Similarity:264/382 - (69%) Gaps:33/382 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 QLLLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSS 135
            ::|:.|||       :.:.:.::|||:|:||..:.||::|.||||||||.|.:|||:|       
  Fly    22 KMLIHLLL-------IVSLLEAIGAFQPEFVESISNVSVAVGRDATFTCHVRHLGGYR------- 72

  Fly   136 APAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKM 200
                |.|:|||.|||.||||:|||:|.|::|.|.|.|||.|:|:.|..||.|.||||:||||||.
  Fly    73 ----VGWLKADTKAIQAIHENVITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKS 133

  Fly   201 QTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTK 265
            |...|:||||||.|:|:||.|::||||.|.:|.|||||:|:|.:|||||||.||:.::....||.
  Fly   134 QIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTL 198

  Fly   266 AQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTL 330
            |.|..||:|.||||:|:|||:|:|||||||||:||||:.|.:||||::||||||||||:.|||.:
  Fly   199 APSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQI 263

  Fly   331 ICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSI 395
            .|:||||||:||||.::.||||:...:|.:.|...:||..:|.:.:::.|..|.|.|:||:|||:
  Fly   264 ECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSL 328

  Fly   396 GDTEGTIRLYEMERP--GKKILR------------DDDLNEVSKNEVVQKDT-RSED 437
            |:.:.:|||||:..|  .|..|.            |.|.|::.|.:...|.| :.||
  Fly   329 GEVDSSIRLYEIPGPNRNKNPLNGGGKGGGAGGSLDADANDILKQKQQVKVTYQPED 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 61/110 (55%)
Ig strand B 115..119 CDD:409353 3/3 (100%)
Ig strand C 139..143 CDD:409353 1/3 (33%)
Ig strand E 174..178 CDD:409353 2/3 (67%)
Ig strand F 188..193 CDD:409353 3/4 (75%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 59/95 (62%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 2/3 (67%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 2/2 (100%)
IG_like 327..405 CDD:214653 34/77 (44%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 4/4 (100%)
Ig strand E 365..376 CDD:409353 3/10 (30%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 50/90 (56%)
Ig strand B 59..63 CDD:409353 3/3 (100%)
Ig strand C 72..76 CDD:409353 2/14 (14%)
Ig strand E 103..111 CDD:409353 5/7 (71%)
Ig 152..240 CDD:472250 54/87 (62%)
Ig strand B 163..167 CDD:409275 1/3 (33%)
Ig strand C 176..180 CDD:409275 1/3 (33%)
Ig strand E 205..209 CDD:409275 2/3 (67%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 2/2 (100%)
Ig 244..337 CDD:472250 45/92 (49%)
Ig strand B 261..265 CDD:409353 1/3 (33%)
Ig strand C 274..278 CDD:409353 3/3 (100%)
Ig strand E 305..309 CDD:409353 1/3 (33%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.