Sequence 1: | NP_001138225.1 | Gene: | DIP-beta / 33125 | FlyBaseID: | FBgn0259245 | Length: | 555 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101052.2 | Gene: | Pdcd1lg2 / 309304 | RGDID: | 1306403 | Length: | 268 | Species: | Rattus norvegicus |
Alignment Length: | 205 | Identity: | 46/205 - (22%) |
---|---|---|---|
Similarity: | 83/205 - (40%) | Gaps: | 48/205 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 LLLLLLLGNCIDLTVSNKISSVGAFEPDFVI--PLENVTIAQGRDATFTC-----VVNNLGG--- 126
Fly 127 --HRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKY 189
Fly 190 MCQVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREI 254
Fly 255 IARNGSHQKT 264 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-beta | NP_001138225.1 | I-set | 98..209 | CDD:254352 | 22/122 (18%) |
ig | 102..195 | CDD:278476 | 19/104 (18%) | ||
IG_like | 219..307 | CDD:214653 | 15/46 (33%) | ||
Ig | 221..307 | CDD:299845 | 14/44 (32%) | ||
Ig | 311..404 | CDD:299845 | |||
IG_like | 327..405 | CDD:214653 | |||
Pdcd1lg2 | NP_001101052.2 | IG_like | 28..119 | CDD:214653 | 20/113 (18%) |
Ig | 137..193 | CDD:299845 | 12/37 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |