DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Pdcd1lg2

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001101052.2 Gene:Pdcd1lg2 / 309304 RGDID:1306403 Length:268 Species:Rattus norvegicus


Alignment Length:205 Identity:46/205 - (22%)
Similarity:83/205 - (40%) Gaps:48/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LLLLLLLGNCIDLTVSNKISSVGAFEPDFVI--PLENVTIAQGRDATFTC-----VVNNLGG--- 126
            :|||||:     |.:|:::..:.|.   |.:  |.|..|:..|...:..|     ....|.|   
  Rat     1 MLLLLLI-----LNLSSQLHHIAAL---FTVTAPKEVYTVDFGSSVSLECDFDRRECTELEGIRA 57

  Fly   127 --HRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKY 189
              .:|..|.||...:...:    :.:|.:.:.                  :.:|..|::.|:|:|
  Rat    58 SLQKVENDTSSQSQRATLL----EELLPLGKA------------------SFHIPSVQVRDSGQY 100

  Fly   190 MCQVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREI 254
            .|.|... .......|.|.:....:..:| |.:.||..|..:|:|:|||:|..:::|:...    
  Rat   101 RCLVICG-AAWDYKYLTVKVKASYVRIDT-GILEVPGTGEVQLICQARGYPLAEVSWQNVS---- 159

  Fly   255 IARNGSHQKT 264
            :..|.||.:|
  Rat   160 VPANTSHIRT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 22/122 (18%)
ig 102..195 CDD:278476 19/104 (18%)
IG_like 219..307 CDD:214653 15/46 (33%)
Ig 221..307 CDD:299845 14/44 (32%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
Pdcd1lg2NP_001101052.2 IG_like 28..119 CDD:214653 20/113 (18%)
Ig 137..193 CDD:299845 12/37 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.