DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Iglon5

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_218634.5 Gene:Iglon5 / 308557 RGDID:1305344 Length:336 Species:Rattus norvegicus


Alignment Length:361 Identity:95/361 - (26%)
Similarity:150/361 - (41%) Gaps:71/361 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PAIRWQLLLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVS 130
            |..|.:||....|...  ..:|..:.|...   :|..|.:|.|:.:|.:||.:|.::.   |   
  Rat     6 PGARLRLLAAAALAGL--AVISRGLLSQSL---EFSSPADNYTVCEGDNATLSCFIDE---H--- 59

  Fly   131 GDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNT 195
                  ..:|||:  :...||.......|::.|:.:..|....:::.|..|.:.|.|.|.|...|
  Rat    60 ------VTRVAWL--NRSNILYAGNDRWTSDPRVRLLINTPEEFSILITQVGLGDEGLYTCSFQT 116

  Fly   196 DPMKMQTATLEVV-IPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNG 259
            ......|....:| :|..|:|  .|..:.|.|||:..|:|.|.|.|:|.:|||:       .|:|
  Rat   117 RHQPYTTQVYLIVHVPARIVN--ISSPVAVNEGGNVNLLCLAVGRPEPTVTWRQ-------LRDG 172

  Fly   260 SHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPV 324
            .       :.|||:|.:|.|.|.:.|.|.|:..|||......|..|....:|           |.
  Rat   173 F-------TSEGEILEISDIQRGQAGEYECVTHNGVNSAPDSRRVLVTVNYP-----------PT 219

  Fly   325 LTDVT-----------LICNVEASPKAINYWQRENGEMIIAGDRYAL---TEKENNMYAIEMILH 375
            :||||           |.|...|.|.|...|.::: .::.:|....|   ||:..:|      |.
  Rat   220 ITDVTSARTALGRAALLRCEAMAVPPADFQWYKDD-RLLSSGSAEGLKVQTERTRSM------LL 277

  Fly   376 IKRLQSSDFGGYKCISKNSIGDTEGTIRLYEMERPG 411
            ...:.:..:|.|.|.:.|.:|.:..::||.   |||
  Rat   278 FANVSARHYGNYTCRAANRLGASSASMRLL---RPG 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 26/111 (23%)
ig 102..195 CDD:278476 22/92 (24%)
IG_like 219..307 CDD:214653 31/87 (36%)
Ig 221..307 CDD:299845 30/85 (35%)
Ig 311..404 CDD:299845 23/106 (22%)
IG_like 327..405 CDD:214653 21/91 (23%)
Iglon5XP_218634.5 Ig 41..129 CDD:416386 23/101 (23%)
Ig strand A' 41..46 CDD:409353 2/4 (50%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 1/15 (7%)
FR2 61..68 CDD:409353 3/8 (38%)
Ig strand C 61..67 CDD:409353 3/7 (43%)
CDR2 69..79 CDD:409353 2/9 (22%)
Ig strand C' 71..74 CDD:409353 2/2 (100%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 9/34 (26%)
Ig strand D 84..91 CDD:409353 1/6 (17%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 1/8 (13%)
FR4 122..129 CDD:409353 1/6 (17%)
Ig strand A 132..137 CDD:409353 2/4 (50%)
Ig_3 134..199 CDD:404760 28/80 (35%)
Ig strand A' 140..145 CDD:409353 0/4 (0%)
Ig strand B 148..157 CDD:409353 3/8 (38%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand D 174..177 CDD:409353 0/2 (0%)
Ig strand E 178..183 CDD:409353 2/4 (50%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig_3 217..295 CDD:404760 21/95 (22%)
putative Ig strand A 218..224 CDD:409353 3/5 (60%)
Ig strand B 234..238 CDD:409353 1/3 (33%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 2/9 (22%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Ig strand G 301..304 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337159
Domainoid 1 1.000 59 1.000 Domainoid score I10374
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4382
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.800

Return to query results.
Submit another query.