DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Btn2a2

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_038952161.1 Gene:Btn2a2 / 306957 RGDID:1306973 Length:555 Species:Rattus norvegicus


Alignment Length:187 Identity:40/187 - (21%)
Similarity:72/187 - (38%) Gaps:33/187 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGH-RVSGDGSSA 136
            ||..|:.:.:.| :|.:.:.:|..||...:..||:|:                 | .::.:.::.
  Rat    15 LLFFLVLSLLAL-LSAQFTVIGPAEPILAMVGENITL-----------------HCHLTPERNAE 61

  Fly   137 PAKVAWIK-ADAKAILAIHEH-------VITNNDRLSVQHNDYNTW--TLNIRGVKMEDAGKYMC 191
            ..:|.|.: ..:.|:|....|       ::....|.:....|.:..  .|.|..|...|.|.|.|
  Rat    62 DMEVRWFRWRFSPAVLVYRGHQERPEEQMVPYQGRTTFMSTDISKGRVALIIHNVTTYDNGIYYC 126

  Fly   192 QVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARG-HPKPKITWR 247
            ... :......||:.:.:..  :..|....|...|.||..|.|.:.| :|:|:..||
  Rat   127 YFQ-EGRSYDQATIRLRVAS--LGSEPLIQMKTLEDGSILLKCTSGGWYPEPRAVWR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 21/121 (17%)
ig 102..195 CDD:278476 18/103 (17%)
IG_like 219..307 CDD:214653 11/30 (37%)
Ig 221..307 CDD:299845 11/28 (39%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
Btn2a2XP_038952161.1 IgV_MOG_like 31..144 CDD:409378 23/130 (18%)
Ig strand B 48..52 CDD:409378 1/20 (5%)
Ig strand C 64..68 CDD:409378 1/3 (33%)
Ig strand E 109..113 CDD:409378 1/3 (33%)
Ig strand F 123..128 CDD:409378 2/4 (50%)
Ig strand G 136..139 CDD:409378 1/2 (50%)
SPRY_PRY_BTN1_2 344..514 CDD:293991
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.