DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Igsf9

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001100667.1 Gene:Igsf9 / 304982 RGDID:1304566 Length:1179 Species:Rattus norvegicus


Alignment Length:377 Identity:90/377 - (23%)
Similarity:132/377 - (35%) Gaps:139/377 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 CIDLTVSNKISSVGA---FEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPA---- 138
            |:.||:.:.|.|.||   .:|:.|                 .||...|...|.|.....||    
  Rat     4 CLRLTILSLILSQGADGRRKPEVV-----------------SVVGRAGESAVLGCDLLPPAGRPP 51

  Fly   139 --KVAWIKADAKAILAIHEHVITNNDRLSVQHNDY-------NTWTLNIRGVKMEDAGKYMCQ-- 192
              .:.|::..  .:|.|.......:.|:.   .||       ...:|.|.|:::||.|.|.|:  
  Rat    52 LHVIEWLRFG--FLLPIFIQFGLYSPRID---PDYVGRVRLQTGASLQIEGLRVEDQGWYECRVL 111

  Fly   193 --------------------VNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRAR 237
                                ||:.|...:|       ||.::.        |.|..:..|.|.|.
  Rat   112 FLDQHSPEQDFANGSWVHLTVNSPPQFQET-------PPLVLE--------VKELEAVTLRCVAL 161

  Fly   238 GHPKPKITW--RRED-GR---EIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVP 296
            |.|:|.:||  |.:| |:   ::..|||:             |.:.::.|...|.|.|.||: ..
  Rat   162 GSPQPYVTWKFRGQDLGKGQGQVQVRNGT-------------LWIRRVERGSAGDYTCQASS-TE 212

  Fly   297 PTVSKRMKLQVHFHPLVQVP--NQLVGAPVLTDVTLICNVEASPKAINY-WQRENGEMIIAGDRY 358
            .:|:...:|.|...|::.||  |..|.|.  .||:|.|..||.|..:.| |.:         ||.
  Rat   213 GSVTHTTQLLVLGPPVIVVPPNNNTVNAS--QDVSLACRAEAYPANLTYSWFQ---------DRI 266

  Fly   359 ALTEKENNMYAIEMILHIKRLQS-----------------SDFGGYKCISKN 393
                         .:.||.||||                 .|.|.|.|:..|
  Rat   267 -------------NVFHISRLQSRVRILVDGSLWLQATQPDDAGHYTCVPSN 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 27/145 (19%)
Ig strand B 115..119 CDD:409353 0/3 (0%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/26 (8%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 211..307 CDD:472250 26/101 (26%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 2/5 (40%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 22/85 (26%)
Ig strand B 328..332 CDD:409353 2/3 (67%)
Ig strand C 341..346 CDD:409353 2/5 (40%)
Ig strand E 365..376 CDD:409353 0/10 (0%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353
Igsf9NP_001100667.1 IG_like 28..110 CDD:214653 21/86 (24%)
Ig strand B 37..41 CDD:409353 1/3 (33%)
Ig strand C 54..58 CDD:409353 0/3 (0%)
Ig strand E 91..95 CDD:409353 1/3 (33%)
IG_like 143..223 CDD:214653 26/101 (26%)
Ig strand B 154..158 CDD:409353 1/3 (33%)
Ig strand C 167..171 CDD:409353 1/3 (33%)
Ig strand E 189..193 CDD:409353 2/16 (13%)
Ig strand F 203..208 CDD:409353 2/4 (50%)
Ig strand G 216..219 CDD:409353 0/2 (0%)
Ig_3 226..305 CDD:464046 27/102 (26%)
Ig 322..407 CDD:472250
Ig strand B 333..344 CDD:409353
Ig strand C 353..358 CDD:409353
Ig strand E 378..382 CDD:409353
Ig strand F 392..397 CDD:409353
Ig 418..503 CDD:472250
Ig strand B 436..440 CDD:409353
Ig strand C 449..453 CDD:409353
Ig strand E 469..473 CDD:409353
Ig strand F 483..488 CDD:409353
Ig strand G 496..499 CDD:409353
FN3 508..599 CDD:238020
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 766..807
PHA03247 <777..1062 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 819..846
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 869..895
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 942..979
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1016..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.