DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Tapbpl

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001100092.1 Gene:Tapbpl / 297602 RGDID:1307893 Length:446 Species:Rattus norvegicus


Alignment Length:338 Identity:70/338 - (20%)
Similarity:125/338 - (36%) Gaps:77/338 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVVKESGERIADISCSQEHTT----KFSPKLSQVAKHRK----LAQLEIASGSGLVGLGTGTGTG 61
            ||.....|.:....||.:..|    ::..:..|.|...|    ::.::::.|...|.:...|...
  Rat   101 LVQIPQAEALLHADCSGKAVTCEIAQYFLQARQEATFEKADWFISNMQVSRGGPSVSIVMKTLRD 165

  Fly    62 SGCGPAIRWQLLLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQ--GRDATFTCVVNNL 124
            ...| |:|...|.:.|....   ||..|:        :|.:..|..|:.|  |...:..|..:..
  Rat   166 DEAG-AVRHPSLNIPLSPQG---TVKTKV--------EFQVTAETQTLNQLLGSSVSLPCRFSMA 218

  Fly   125 GG-----------HRVSGD--------GSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHND 170
            .|           |:.||.        ...|..|.|.:|.         |.::...|.       
  Rat   219 PGLDLTGVEWRLQHKGSGQLVYSWKTGQGQAKRKGATLKP---------EKLLRAGDA------- 267

  Fly   171 YNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCR 235
                :|.:..:.::|.|.|:||::|...:.|.     ::|.:|:.......::..:.....|:|.
  Rat   268 ----SLTLPNLTLKDEGNYICQISTSLYQAQQ-----IVPLNILASPKVQLILANKDPLPSLICS 323

  Fly   236 ARG-HP-KPKITWRREDGREIIAR-NGSHQKTKAQSVEGEMLTLSKITRSEMG----AYMCIASN 293
            ..| :| ...:||.||:...|.|: :|:...:..|::.|.....|.:| :|.|    .|.|..::
  Rat   324 IAGYYPLDVVVTWIREELGGIPAQVSGASFSSLRQNMMGTYSISSTVT-AEPGPTGATYTCQVAH 387

  Fly   294 ---GVPPTVSKRM 303
               ..|.|||.|:
  Rat   388 VSLEEPLTVSMRV 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 24/131 (18%)
ig 102..195 CDD:278476 21/113 (19%)
IG_like 219..307 CDD:214653 24/95 (25%)
Ig 221..307 CDD:299845 24/93 (26%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
TapbplNP_001100092.1 V-set 205..302 CDD:284989 21/121 (17%)
IG_like 205..301 CDD:214653 21/120 (18%)
Ig 267..397 CDD:299845 31/146 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.