DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr7

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:232 Identity:56/232 - (24%)
Similarity:87/232 - (37%) Gaps:43/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 DFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDR 163
            |.:.| .||:......|...|.|.|.|...||           |::.....||..:.:..|.:.|
  Fly    54 DDISP-RNVSAVVDEIAILRCRVKNKGNRTVS-----------WMRKRDLHILTTNIYTYTGDQR 106

  Fly   164 LSVQH-NDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEET--------- 218
            .||.| .....|.|.|...:..|:|.|.|||||:|.......|:|:...|..:.:|         
  Fly   107 FSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKS 171

  Fly   219 -------SGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREII----ARNGSHQKTKAQSV-EG 271
                   |.::.|....:..|.|....| .|.:.|..  |..::    .|.|...:|:...| ..
  Fly   172 ARAKILGSTEIHVKRDSTIALACSVNIH-APSVIWYH--GSSVVDFDSLRGGISLETEKTDVGTT 233

  Fly   272 EMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVH 308
            ..|.|::.:..:.|.|.|:.:..:|.:|      :||
  Fly   234 SRLMLTRASLRDSGNYTCVPNGAIPASV------RVH 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 33/110 (30%)
ig 102..195 CDD:278476 27/93 (29%)
IG_like 219..307 CDD:214653 19/92 (21%)
Ig 221..307 CDD:299845 18/90 (20%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
dpr7NP_001096850.2 V-set 56..145 CDD:284989 30/100 (30%)
IG_like 58..140 CDD:214653 28/93 (30%)
IG_like 179..265 CDD:214653 21/95 (22%)
Ig 187..257 CDD:299845 15/72 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.