DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr7

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:232 Identity:56/232 - (24%)
Similarity:87/232 - (37%) Gaps:43/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 DFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDR 163
            |.:.| .||:......|...|.|.|.|...||           |::.....||..:.:..|.:.|
  Fly    54 DDISP-RNVSAVVDEIAILRCRVKNKGNRTVS-----------WMRKRDLHILTTNIYTYTGDQR 106

  Fly   164 LSVQH-NDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEET--------- 218
            .||.| .....|.|.|...:..|:|.|.|||||:|.......|:|:...|..:.:|         
  Fly   107 FSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKS 171

  Fly   219 -------SGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREII----ARNGSHQKTKAQSV-EG 271
                   |.::.|....:..|.|....| .|.:.|..  |..::    .|.|...:|:...| ..
  Fly   172 ARAKILGSTEIHVKRDSTIALACSVNIH-APSVIWYH--GSSVVDFDSLRGGISLETEKTDVGTT 233

  Fly   272 EMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVH 308
            ..|.|::.:..:.|.|.|:.:..:|.:|      :||
  Fly   234 SRLMLTRASLRDSGNYTCVPNGAIPASV------RVH 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 33/110 (30%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 2/3 (67%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 21/116 (18%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 0/3 (0%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653
Ig strand B 328..332 CDD:409353
Ig strand C 341..346 CDD:409353
Ig strand E 365..376 CDD:409353
Ig strand F 386..391 CDD:409353
Ig strand G 399..402 CDD:409353
dpr7NP_001096850.2 V-set 56..145 CDD:462230 30/100 (30%)
Ig 184..267 CDD:472250 20/90 (22%)
Ig strand B 190..194 CDD:409353 1/3 (33%)
Ig strand C 202..206 CDD:409353 0/3 (0%)
Ig strand E 234..238 CDD:409353 1/3 (33%)
Ig strand G 261..264 CDD:409353 1/8 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.