DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr1

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_995908.2 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:277 Identity:77/277 - (27%)
Similarity:114/277 - (41%) Gaps:50/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IRWQLLL--LLLLGNCIDLTVSNKISSVGAFEP-------DFVIPLENVTIAQGRDATFTCVVNN 123
            |.|.|||  :||.|....|..:...:|.....|       ||.:| .|:|:..|:.....|.|..
  Fly    16 IGWLLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVP-RNLTVTVGQTGFLHCRVER 79

  Fly   124 LGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYN-TWTLNIRGVKMEDAG 187
            ||...||           ||:.....||.......|::.|..|...|.: .|||.|:..:..|:|
  Fly    80 LGDKDVS-----------WIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSG 133

  Fly   188 KYMCQVNTDPMKMQTATLEVV-IPPDIINEETSGDMMVPEGGSAKLVCR-ARG-HPKPKITWRRE 249
            .|.||:||:|....:.|..|| :..:|..   ..|:||..|....|.|: .:| |....|.|.: 
  Fly   134 VYECQINTEPKMSLSYTFNVVELKAEIFG---PSDLMVKTGSDINLTCKIMQGPHELGNIFWYK- 194

  Fly   250 DGREIIARNGSHQKTKAQS---VEGE----MLTLSKITRS---EMGAYMCIASNGVPPTVSKRMK 304
             |.|::...|.::...:.:   ||.:    :.:..||.|:   :.|.|.|:      |||:|...
  Fly   195 -GSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCV------PTVAKTSS 252

  Fly   305 LQVHF----HPLVQVPN 317
            :.||.    ||.....|
  Fly   253 VYVHVIIGEHPAAMQHN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 36/119 (30%)
Ig strand B 115..119 CDD:409353 0/3 (0%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 3/3 (100%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 26/107 (24%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 0/7 (0%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 1/2 (50%)
IG_like 327..405 CDD:214653
Ig strand B 328..332 CDD:409353
Ig strand C 341..346 CDD:409353
Ig strand E 365..376 CDD:409353
Ig strand F 386..391 CDD:409353
Ig strand G 399..402 CDD:409353
dpr1NP_995908.2 Ig 53..138 CDD:472250 27/96 (28%)
Ig strand A' 63..65 CDD:409355 0/1 (0%)
Ig strand B 69..77 CDD:409355 1/7 (14%)
CDR1 77..83 CDD:409355 3/5 (60%)
Ig strand C 84..90 CDD:409355 4/16 (25%)
CDR2 93..109 CDD:409355 3/15 (20%)
Ig strand D 109..114 CDD:409355 1/4 (25%)
FR3 110..147 CDD:409355 14/36 (39%)
Ig strand E 119..125 CDD:409355 3/5 (60%)
Ig strand F 133..148 CDD:409355 7/14 (50%)
CDR3 148..160 CDD:409355 3/11 (27%)
IG_like 163..257 CDD:214653 26/101 (26%)
Ig strand B 174..178 CDD:409355 1/3 (33%)
Ig strand C 189..193 CDD:409355 1/3 (33%)
Ig strand E 226..230 CDD:409355 0/3 (0%)
Ig strand F 240..244 CDD:409355 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.