DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and dpr9

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_996215.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:233 Identity:61/233 - (26%)
Similarity:92/233 - (39%) Gaps:27/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 NCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIK 144
            |.|||..:......  |:..|   .:|||...|:.|...|.|.|||       ..:...:|:|::
  Fly   244 NSIDLEEARNAGPY--FDKAF---SKNVTALLGKTAYLNCRVKNLG-------NKTMLLQVSWVR 296

  Fly   145 ADAKAILAIHEHVITNNDRLSVQHN-DYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVV 208
            .....:|.:..:..|::.|....|. ....|.|.|:..:..|:|.|.|||:|.|.......|.||
  Fly   297 HRDIHLLTVGRYTYTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVV 361

  Fly   209 IP-PDIINEETSGDMMVPEGGSAKLVCRARGHPKPK--ITWRREDG----REII----ARNGSHQ 262
            .| .:||.   :.|:.:..|.:..|.|..:..|:|.  |.|...:.    .:||    .|.|...
  Fly   362 EPSTEIIG---APDLYIESGSTINLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSV 423

  Fly   263 KTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVS 300
            .|.........|.:.....|:.|.|.|..||..|.:|:
  Fly   424 VTNKGDTTTSFLLIKSARPSDSGHYQCNPSNAKPKSVT 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 30/111 (27%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 1/3 (33%)
Ig strand E 174..178 CDD:409353 2/3 (67%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 24/100 (24%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/5 (20%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/1 (0%)
IG_like 327..405 CDD:214653
Ig strand B 328..332 CDD:409353
Ig strand C 341..346 CDD:409353
Ig strand E 365..376 CDD:409353
Ig strand F 386..391 CDD:409353
Ig strand G 399..402 CDD:409353
dpr9NP_996215.1 IG_like 263..360 CDD:214653 28/103 (27%)
Ig strand B 274..278 CDD:409355 1/3 (33%)
Ig strand C 291..295 CDD:409355 1/3 (33%)
Ig strand E 327..331 CDD:409355 2/3 (67%)
Ig strand F 341..346 CDD:409355 2/4 (50%)
IG_like 371..464 CDD:214653 22/91 (24%)
Ig strand B 381..385 CDD:143220 1/3 (33%)
Ig strand C 396..400 CDD:143220 1/3 (33%)
Ig strand E 431..437 CDD:143220 1/5 (20%)
Ig strand F 447..452 CDD:143220 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.