DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and MDGA1

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_006715119.1 Gene:MDGA1 / 266727 HGNCID:19267 Length:973 Species:Homo sapiens


Alignment Length:465 Identity:112/465 - (24%)
Similarity:185/465 - (39%) Gaps:93/465 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LAQLEIASGSGLVGLGTGTGTGSGCGPAIR------WQLLLLLLLGNCIDLTVSNKISSV--GAF 96
            |.||:.:.|.|.:.||.....|:...|:::      :.......:||....||:..:.|:  ..|
Human   270 LPQLQWSHGPGPLPLGALAQGGTLSIPSVQARDSGYYNCTATNNVGNPAKKTVNLLVRSMKNATF 334

  Fly    97 E--PDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVIT 159
            :  ||.:...||:.:  |:|...:|.|:.:...:|:         ..|.|....|.:        
Human   335 QITPDVIKESENIQL--GQDLKLSCHVDAVPQEKVT---------YQWFKNGKPARM-------- 380

  Fly   160 NNDRLSVQHNDYN----TWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEV-----VIPPDIIN 215
             :.||.|..||..    |.:|.:..:...|.|.|:|..:.....:...::||     .:||.|..
Human   381 -SKRLLVTRNDPELPAVTSSLELIDLHFSDYGTYLCMASFPGAPVPDLSVEVNISSETVPPTISV 444

  Fly   216 EETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKIT 280
            .:....:.|.||..|:|.|..||.|:|.:.|.|.|....:..:|...:   ::.:|: |.|.:::
Human   445 PKGRAVVTVREGSPAELQCEVRGKPRPPVLWSRVDKEAALLPSGLPLE---ETPDGK-LRLERVS 505

  Fly   281 RSEMGAYMCIAS--NG--VPPTVSKRMKLQVHFHPLV----QVPNQLVGAPVLTDVTLICNVEAS 337
            |...|.|.|..:  ||  |.|. ..:::|.|.|.|.|    |...|.:|.|||...:|:   ..|
Human   506 RDMSGTYRCQTARYNGFNVRPR-EAQVQLNVQFPPEVEPSSQDVRQALGRPVLLRCSLL---RGS 566

  Fly   338 PKAI--NYWQRENGEM-----IIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSI 395
            |:.|  ..| |..|::     ::.....|....|         |.:..:.....|.|:|...|.:
Human   567 PQRIASAVW-RFKGQLLPPPPVVPAAAEAPDHAE---------LRLDAVTRDSSGSYECSVSNDV 621

  Fly   396 GDT----EGTIRLYEME------RPGKKILRDDDLNEVSKN--EVVQKDTRSEDG-SRNLNGRLY 447
            |..    :.:.:.|..|      .|.:.       :::|||  .|:|...|..|. ...||.|| 
Human   622 GSAACLFQVSAKAYSPEFYFDTPNPTRS-------HKLSKNYSYVLQWTQREPDAVDPVLNYRL- 678

  Fly   448 KDRAPDQHPA 457
            ..|..:||.|
Human   679 SIRQLNQHNA 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 25/119 (21%)
Ig strand B 115..119 CDD:409353 0/3 (0%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 28/99 (28%)
Ig strand B 230..234 CDD:409353 2/3 (67%)
Ig strand C 243..247 CDD:409353 0/3 (0%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 15/88 (17%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 2/6 (33%)
Ig strand E 365..376 CDD:409353 1/10 (10%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)
MDGA1XP_006715119.1 Ig 44..115 CDD:472250
Ig strand B 56..60 CDD:409353
Ig strand C 69..73 CDD:409353
Ig strand E 91..95 CDD:409353
Ig strand F 105..110 CDD:409353
IG_like 152..217 CDD:214653
Ig strand B 153..157 CDD:409353
Ig strand C 166..170 CDD:409353
Ig strand E 197..201 CDD:409353
Ig strand F 211..216 CDD:409353
IG_like 248..326 CDD:214653 13/55 (24%)
Ig strand B 258..262 CDD:409412
Ig strand C 272..276 CDD:409412 2/3 (67%)
Ig strand E 291..295 CDD:409412 1/3 (33%)
Ig strand F 305..310 CDD:409412 0/4 (0%)
Ig 334..418 CDD:472250 24/103 (23%)
Ig strand B 353..357 CDD:409353 0/3 (0%)
Ig strand C 368..372 CDD:409353 0/12 (0%)
Ig strand E 398..402 CDD:409353 1/3 (33%)
Ig strand F 412..417 CDD:409353 2/4 (50%)
Ig_3 439..515 CDD:464046 23/79 (29%)
Ig_3 538..619 CDD:464046 21/93 (23%)
MAM 753..916 CDD:99706
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.