DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Ceacam3

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_036834.2 Gene:Ceacam3 / 24926 RGDID:2333 Length:709 Species:Rattus norvegicus


Alignment Length:438 Identity:89/438 - (20%)
Similarity:154/438 - (35%) Gaps:148/438 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 VAWIKADAKAI----LAIHEHVI-TNNDRLSVQHND----YNTWTLNIRGVKMEDAGKYMCQVNT 195
            :.|.|.   ||    |.:..:|| ||:......||.    |:..:|.::.|...|||.|..:..:
  Rat   185 IFWYKG---AIVFKDLEVARYVIGTNSSVPGPAHNGRETMYSNGSLLLQNVTRNDAGFYTLKTLS 246

  Fly   196 DPMKMQTATLEVVI---------PPDIINEETSGDM-------MVPEGGSAKLVCRARGHPKPK- 243
            ..:|.:.|.:::.:         ||      ||..:       .|.||.|..|:    .|..|: 
  Rat   247 TDLKTEIAYVQLQV
DTCFMSYAGPP------TSAQLTVESAPTSVAEGASVLLL----AHNLPEN 301

  Fly   244 ---ITWRR--------EDGREIIARNGS-----HQKTKAQSVEGEMLTLSKITRSEMGAYMCIAS 292
               |.|.:        |..|.:|..|.|     |...:.....|.:| |..:||::.|.|..   
  Rat   302 LRAIFWYKGAILFKDLEVARYVIGTNSSVPGPAHSGRETMHSNGSLL-LQNVTRNDAGFYTL--- 362

  Fly   293 NGVPPTVSKRMKLQVHFHPLVQVP-----NQLVGAPVLTD------------------------- 327
                .|:|..:|.:| .|..:||.     :.|..||:..|                         
  Rat   363 ----RTLSTDLKAKV-VHVQLQV
NTSSCCDPLTPAPLTIDPVPRHAAKGESVLLQVRNLPEDLRM 422

  Fly   328 --------VTLICNVEASPKAINYWQR-----------ENGEMIIAGDRYALTEKENNMYAIEMI 373
                    .:.|..:....:||||..|           .||.:::..    .|||:..:|.:::|
  Rat   423 FIWFKSVYTSQIFKIAEYSRAINYVFRGPAHSGRETVYTNGSLLLQD----ATEKDTGLYTLQII 483

  Fly   374 LHIKRLQSS--DFGGYKCISKNSIGD-----------TEGTIRLYEMERP----------GKKIL 415
            ....:::::  ....:.|:..::.|.           ..|.:.|.....|          |..|:
  Rat   484 YRNFKIETAHVQVSVHTCVHPSTTGQLVIESVPPNVVEGGDVLLLVHNMPENLQSFSWYKGVAIV 548

  Fly   416 RDDDLNEVSKNEVVQKDTRSEDGSRNLNGR--LYKDRAPDQHPASGSD 461
               :.:|:|:|.:.  ..||..|..: :||  :|.:.:...|.|:..|
  Rat   549 ---NRHEISRNIIA--SNRSTLGPAH-SGRETIYSNGSLLLHNATEED 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 20/77 (26%)
ig 102..195 CDD:278476 18/63 (29%)
IG_like 219..307 CDD:214653 26/111 (23%)
Ig 221..307 CDD:299845 25/109 (23%)
Ig 311..404 CDD:299845 22/154 (14%)
IG_like 327..405 CDD:214653 17/134 (13%)
Ceacam3NP_036834.2 Ig_CEACAM_D1 36..140 CDD:143251
IG_like 45..137 CDD:214653
Ig_CEACAM_D1 156..260 CDD:143251 20/77 (26%)
Ig_CEACAM_D1 276..380 CDD:143251 27/116 (23%)
Ig_CEACAM_D1 394..498 CDD:143251 14/107 (13%)
Ig_CEACAM_D1 510..614 CDD:143251 17/87 (20%)
Ig 616..706 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.