DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Vtcn1

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_848709.2 Gene:Vtcn1 / 242122 MGIID:3039619 Length:283 Species:Mus musculus


Alignment Length:283 Identity:62/283 - (21%)
Similarity:99/283 - (34%) Gaps:74/283 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GPAIRWQLL-LLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQ--GRDATFTCVVN---N 123
            |..|.|.:: ::::|...|.|.:...||.      ...|.:...|.|.  |.|.|.:|...   .
Mouse     5 GQIIFWSIINIIIILAGAIALIIGFGISG------KHFITVTTFTSAGNIGEDGTLSCTFEPDIK 63

  Fly   124 LGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWT------------- 175
            |.|           ..:.|:|...|.:  :||.. ...|.||.||..:...|             
Mouse    64 LNG-----------IVIQWLKEGIKGL--VHEFK-EGKDDLSQQHEMFRGRTAVFADQVVVGNAS 114

  Fly   176 LNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPE------GGSAKLVC 234
            |.::.|::.|||.|.|.:.|...| ..|.||.          .:|...:||      ..|..|.|
Mouse   115 LRLKNVQLTDAGTYTCYIRTSKGK-GNANLEY----------KTGAFSMPEINVDYNASSESLRC 168

  Fly   235 RA-RGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKIT----RSEMGAYMCIASNG 294
            .| |..|:|.:.|..:..:   ..|.|.....:..:..|.:|:..::    .:....|.|:..|.
Mouse   169 EAPRWFPQPTVAWASQVDQ---GANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIEND 230

  Fly   295 VPPT----------VSKRMKLQV 307
            :...          |.:|.:||:
Mouse   231 IAKATGDIKVTDSEVKRRSQLQL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 32/128 (25%)
ig 102..195 CDD:278476 27/110 (25%)
IG_like 219..307 CDD:214653 21/108 (19%)
Ig 221..307 CDD:299845 20/106 (19%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
Vtcn1NP_848709.2 IG_like 46..144 CDD:214653 27/112 (24%)
Ig 49..146 CDD:299845 29/121 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.