DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Ntm

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001344522.1 Gene:Ntm / 235106 MGIID:2446259 Length:367 Species:Mus musculus


Alignment Length:426 Identity:117/426 - (27%)
Similarity:179/426 - (42%) Gaps:89/426 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 NCIDLTVSNKISSVGAFE------PDFVIP--LENVTIAQGRDATFTCVVNNLGGHRVSGDGSSA 136
            |.|...:...::::..|:      .|...|  ::|||:.||..||..|.::|    ||:      
Mouse    10 NSISWAIFTGLAALCLFQGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDN----RVT------ 64

  Fly   137 PAKVAWIKADAKAILAIHEHVITNND------RLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNT 195
              :|||:  :...||      ...||      |:.:..|....:::.|:.|.:.|.|.|.|.|.|
Mouse    65 --RVAWL--NRSTIL------YAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQT 119

  Fly   196 D--PMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARN 258
            |  | |.....|.|.:.|.|:  |.|.|:.:.||.:..|.|.|.|.|:|.:|||           
Mouse   120 DNHP-KTSRVHLIVQVSPKIV--EISSDISINEGNNISLTCIATGRPEPTVTWR----------- 170

  Fly   259 GSHQKTKAQSV--EGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVG 321
              |...||...  |.|.|.:..|||.:.|.|.|.|||.|...|.:|:|:.|::.|.:..... .|
Mouse   171 --HISPKAVGFVSEDEYLEIQGITREQSGEYECSASNDVAAPVVRRVKVTVNYPPYISEAKG-TG 232

  Fly   322 APVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGG 386
            .||....||.|...|.|.|...|.::: :.::.|.:.  .:.||..:..::...  .:...|:|.
Mouse   233 VPVGQKGTLQCEASAVPSAEFQWFKDD-KRLVEGKKG--VKVENRPFLSKLTFF--NVSEHDYGN 292

  Fly   387 YKCISKNSIGDTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQKDTRSEDGSRNLNGRLYKDRA 451
            |.|::.|.:|.|..:|.|:|:..|....|    |.||....:                      .
Mouse   293 YTCVASNKLGHTNASIMLFELNEPTSSTL----LQEVKTTAL----------------------T 331

  Fly   452 PDQHPASGSDQLLGRGTMRLIG-TFLLALLVLFTAL 486
            |.:.|.:.|:  :..||.|..| .:||.||||...|
Mouse   332 PWKGPGAVSE--VNNGTSRRAGCIWLLPLLVLHLLL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 35/120 (29%)
ig 102..195 CDD:278476 28/100 (28%)
IG_like 219..307 CDD:214653 32/89 (36%)
Ig 221..307 CDD:299845 31/87 (36%)
Ig 311..404 CDD:299845 22/92 (24%)
IG_like 327..405 CDD:214653 18/77 (23%)
NtmNP_001344522.1 Ig 44..132 CDD:416386 32/108 (30%)
Ig strand A' 44..49 CDD:409353 3/4 (75%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 1/7 (14%)
FR2 64..70 CDD:409353 3/15 (20%)
Ig strand C 64..70 CDD:409353 3/15 (20%)
CDR2 71..83 CDD:409353 4/17 (24%)
Ig strand C' 72..76 CDD:409353 2/9 (22%)
Ig strand C' 80..83 CDD:409353 1/2 (50%)
FR3 84..118 CDD:409353 8/33 (24%)
Ig strand D 87..94 CDD:409353 1/6 (17%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 2/3 (67%)
Ig strand G 123..132 CDD:409353 3/9 (33%)
FR4 125..132 CDD:409353 1/6 (17%)
Ig_3 136..205 CDD:404760 29/83 (35%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 2/8 (25%)
Ig strand F 197..205 CDD:409353 4/7 (57%)
Ig_3 222..299 CDD:404760 18/82 (22%)
putative Ig strand A 223..229 CDD:409353 1/5 (20%)
Ig strand B 239..243 CDD:409353 2/3 (67%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 0/3 (0%)
Ig strand F 292..297 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833572
Domainoid 1 1.000 59 1.000 Domainoid score I10599
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.