DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Igsf9b

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:531 Identity:127/531 - (23%)
Similarity:187/531 - (35%) Gaps:167/531 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIH-----EH 156
            ||:|      ||...|......|.|.    |.|:  |...|..|.|.|......:.|.     .|
Mouse    31 EPEF------VTARAGEGVVLRCDVI----HPVT--GQPPPYVVEWFKFGVPIPIFIKFGYYPPH 83

  Fly   157 VITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQV--------------------NTDPMKMQ 201
            |   :...:.:.:.::..:|.:..|:.||.|.|.|:|                    |..|...:
Mouse    84 V---DPEYAGRASLHDKASLRLEQVRSEDQGWYECKVLMLDQQYDTFHNGSWVHLTINAPPTFTE 145

  Fly   202 TATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKA 266
            |       ||..|..:        ||||..:.|.|.|:|||.:||.:|.  .::..:..:|    
Mouse   146 T-------PPQYIEAK--------EGGSITMTCTAFGNPKPIVTWLKEG--TLLGASAKYQ---- 189

  Fly   267 QSVEGEMLTLSKITRSEMGAYMC----IASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAP---- 323
              |....||::.::|.:.|||.|    |....|..|           |.|||.|..:|..|    
Mouse   190 --VSDGSLTVTSVSREDRGAYTCRAYSIQGEAVHTT-----------HLLVQGPPFIVSPPENIT 241

  Fly   324 --VLTDVTLICNVEASPKAIN---YWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSD 383
              :..|..|.|..||.|..:.   |||.||  :....|.     |......|:..|.|.|::..|
Mouse   242 VNISQDALLTCRAEAYPGNLTYTWYWQDEN--VYFQNDL-----KLRVRILIDGTLIIFRVKPED 299

  Fly   384 FGGYKCISKNSIGDT----------------------------EGTIRLYEMERPGKKILRDDDL 420
            .|.|.|:..||:|.:                            .|.||......|...:::   .
Mouse   300 AGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATVVK---W 361

  Fly   421 NEVSKNEVVQKD---TRSEDGSRNLNGRLYKDRAPDQHPASGSDQLLGRGTMRLIGTFLLALLVL 482
            |:..:...|:|:   |..||||..:      :.|.::  |.|:...:...|:..:|....|.|||
Mouse   362 NKDGRPLQVEKNLGWTLMEDGSIRI------EEATEE--ALGTYTCVPYNTLGTMGQSAPARLVL 418

  Fly   483 -----FTAL------AEAGPTTL-SCRTKG-----------GRQKKAKETSW-NGR---RARDGR 520
                 ||.|      .|||...| .|...|           |:..::|..:. :|.   ||....
Mouse   419 KDPPYFTVLPGWEYRQEAGRELLIPCAAAGDPFPVITWRKVGKPSRSKHNALPSGSLQFRALSKE 483

  Fly   521 EDGHAAEWRQC 531
            :.|   || :|
Mouse   484 DHG---EW-EC 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 28/135 (21%)
Ig strand B 115..119 CDD:409353 0/3 (0%)
Ig strand C 139..143 CDD:409353 1/3 (33%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 211..307 CDD:472250 27/99 (27%)
Ig strand B 230..234 CDD:409353 0/3 (0%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 3/8 (38%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 27/108 (25%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 2/7 (29%)
Ig strand E 365..376 CDD:409353 2/10 (20%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 1/2 (50%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:409353 19/82 (23%)
Ig strand B 43..47 CDD:409353 0/3 (0%)
Ig strand C 61..65 CDD:409353 1/3 (33%)
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
I-set 141..227 CDD:400151 31/119 (26%)
Ig strand B 159..163 CDD:409353 0/3 (0%)
Ig strand C 172..176 CDD:409353 1/3 (33%)
Ig strand E 193..197 CDD:409353 1/3 (33%)
Ig strand F 207..212 CDD:409353 3/4 (75%)
Ig strand G 220..223 CDD:409353 1/2 (50%)
Ig_3 230..309 CDD:464046 24/85 (28%)
Ig 338..412 CDD:472250 17/84 (20%)
Ig strand B 344..348 CDD:409353 2/3 (67%)
Ig strand C 357..362 CDD:409353 0/7 (0%)
Ig strand E 382..386 CDD:409353 2/3 (67%)
Ig strand F 396..401 CDD:409353 0/4 (0%)
Ig strand G 409..412 CDD:409353 1/2 (50%)
Ig 431..507 CDD:472250 15/64 (23%)
Ig strand B 440..444 CDD:409353 1/3 (33%)
Ig strand C 453..457 CDD:409353 0/3 (0%)
Ig strand E 473..477 CDD:409353 1/3 (33%)
Ig strand F 487..492 CDD:409353 3/5 (60%)
FN3 <492..>737 CDD:442628
Ig strand G 500..503 CDD:409353
FN3 512..607 CDD:238020
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.