DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Igsf9b

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:531 Identity:127/531 - (23%)
Similarity:187/531 - (35%) Gaps:167/531 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIH-----EH 156
            ||:|      ||...|......|.|.    |.|:  |...|..|.|.|......:.|.     .|
Mouse    31 EPEF------VTARAGEGVVLRCDVI----HPVT--GQPPPYVVEWFKFGVPIPIFIKFGYYPPH 83

  Fly   157 VITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQV--------------------NTDPMKMQ 201
            |   :...:.:.:.::..:|.:..|:.||.|.|.|:|                    |..|...:
Mouse    84 V---DPEYAGRASLHDKASLRLEQVRSEDQGWYECKVLMLDQQYDTFHNGSWVHLTINAPPTFTE 145

  Fly   202 TATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKA 266
            |       ||..|..:        ||||..:.|.|.|:|||.:||.:|.  .::..:..:|    
Mouse   146 T-------PPQYIEAK--------EGGSITMTCTAFGNPKPIVTWLKEG--TLLGASAKYQ---- 189

  Fly   267 QSVEGEMLTLSKITRSEMGAYMC----IASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAP---- 323
              |....||::.::|.:.|||.|    |....|..|           |.|||.|..:|..|    
Mouse   190 --VSDGSLTVTSVSREDRGAYTCRAYSIQGEAVHTT-----------HLLVQGPPFIVSPPENIT 241

  Fly   324 --VLTDVTLICNVEASPKAIN---YWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSD 383
              :..|..|.|..||.|..:.   |||.||  :....|.     |......|:..|.|.|::..|
Mouse   242 VNISQDALLTCRAEAYPGNLTYTWYWQDEN--VYFQNDL-----KLRVRILIDGTLIIFRVKPED 299

  Fly   384 FGGYKCISKNSIGDT----------------------------EGTIRLYEMERPGKKILRDDDL 420
            .|.|.|:..||:|.:                            .|.||......|...:::   .
Mouse   300 AGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATVVK---W 361

  Fly   421 NEVSKNEVVQKD---TRSEDGSRNLNGRLYKDRAPDQHPASGSDQLLGRGTMRLIGTFLLALLVL 482
            |:..:...|:|:   |..||||..:      :.|.::  |.|:...:...|:..:|....|.|||
Mouse   362 NKDGRPLQVEKNLGWTLMEDGSIRI------EEATEE--ALGTYTCVPYNTLGTMGQSAPARLVL 418

  Fly   483 -----FTAL------AEAGPTTL-SCRTKG-----------GRQKKAKETSW-NGR---RARDGR 520
                 ||.|      .|||...| .|...|           |:..::|..:. :|.   ||....
Mouse   419 KDPPYFTVLPGWEYRQEAGRELLIPCAAAGDPFPVITWRKVGKPSRSKHNALPSGSLQFRALSKE 483

  Fly   521 EDGHAAEWRQC 531
            :.|   || :|
Mouse   484 DHG---EW-EC 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 28/135 (21%)
ig 102..195 CDD:278476 23/117 (20%)
IG_like 219..307 CDD:214653 25/91 (27%)
Ig 221..307 CDD:299845 25/89 (28%)
Ig 311..404 CDD:299845 32/129 (25%)
IG_like 327..405 CDD:214653 27/108 (25%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273 19/82 (23%)
I-set 141..227 CDD:369462 31/119 (26%)
Ig 231..323 CDD:386229 26/98 (27%)
Ig <355..416 CDD:386229 14/71 (20%)
Ig 440..504 CDD:319273 12/55 (22%)
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.