DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Vsig10

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001028483.2 Gene:Vsig10 / 231668 MGIID:2448533 Length:558 Species:Mus musculus


Alignment Length:362 Identity:72/362 - (19%)
Similarity:136/362 - (37%) Gaps:78/362 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRD-ATFTCVVNNLGGHRVSGDGSSA 136
            |.|||..:..:|:|......:....||    ||.|.|.:..| .|..|           |..|.:
Mouse    22 LQLLLNPSRANLSVRPNSEVLPGIHPD----LEAVAIGEVHDNVTLRC-----------GSASGS 71

  Fly   137 PAKVAWIKADAKA--ILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQ-----VN 194
            ...|.|.:.|::.  :::.:..:.....|.|::    :...|.|..:::||.|.|.||     .:
Mouse    72 RGLVTWYRNDSEPAFLVSFNSSLPPAAPRFSLE----DAGALRIEALRLEDDGNYTCQEVLNETH 132

  Fly   195 TDPMKMQTATLEVVIPPDIINEET--SGDMMVPEGGSAKLVCRARGHPKPKITW--RREDGREII 255
            ..|::::.|:....:..:|....|  :|.:....|......|.:...|.|::.|  :.....|.:
Mouse   133 WFPVRLRVASGPAYVEVNISATGTLPNGTLYAARGSQVDFNCCSAAQPPPEVEWWIQTHSIPEFL 197

  Fly   256 ARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMK-----LQVHFHP---- 311
            .:|          :.....||..::::..|.|.|.|:|    .:|.|.:     |.|::.|    
Mouse   198 GKN----------LSANSFTLMLMSQNLQGNYTCSATN----VLSGRQRKVTTELLVYWPPPSAP 248

  Fly   312 --LVQVPNQLVGAPVLTDVTLICNVEAS-PKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMI 373
              .|:|.::      .|.:.|.||.:.. |.....|..|.|..|:...:            ::.:
Mouse   249 QCSVEVSSE------STTLELACNWDGGYPDPTFLWTEEPGGTIMGNSK------------LQTL 295

  Fly   374 LHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEMERP 410
            ...:.|:...|   ||:..:.:|...|...:.::..|
Mouse   296 SPAQLLEGKKF---KCVGNHILGPESGASCVVKLSSP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 26/118 (22%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 1/3 (33%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 3/9 (33%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 211..307 CDD:472250 20/104 (19%)
Ig strand B 230..234 CDD:409353 0/3 (0%)
Ig strand C 243..247 CDD:409353 1/5 (20%)
Ig strand E 272..276 CDD:409353 0/3 (0%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 1/2 (50%)
IG_like 327..405 CDD:214653 14/78 (18%)
Ig strand B 328..332 CDD:409353 1/3 (33%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 0/10 (0%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 1/2 (50%)
Vsig10NP_001028483.2 IG_like 55..140 CDD:214653 19/99 (19%)
Ig strand B 61..65 CDD:409353 1/3 (33%)
Ig strand C 74..78 CDD:409353 1/3 (33%)
Ig strand E 107..111 CDD:409353 1/3 (33%)
Ig strand F 121..125 CDD:409353 1/3 (33%)
IG_like 160..240 CDD:214653 18/93 (19%)
Ig strand B 170..174 CDD:409353 0/3 (0%)
Ig strand C 183..187 CDD:409353 0/3 (0%)
Ig strand E 208..212 CDD:409353 1/3 (33%)
Ig strand F 218..223 CDD:409353 2/4 (50%)
Ig strand G 232..235 CDD:409353 0/2 (0%)
IG_like 341..421 CDD:214653
Ig strand B 345..349 CDD:409353
Ig strand C 359..363 CDD:409353
Ig strand E 386..390 CDD:409353
Ig strand F 401..406 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 477..515
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..558
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.