DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and zig-4

DIOPT Version :9

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:241 Identity:49/241 - (20%)
Similarity:88/241 - (36%) Gaps:66/241 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 TDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNG 259
            |.|.|     :::|.|.:        ..::|.|.:.:|.|.....|...|.| :.:|:.|...|.
 Worm    41 TSPAK-----IKIVAPLE--------SALIPGGETYQLRCDIMSTPAATIHW-KFNGKLIQGSNE 91

  Fly   260 SHQKTKA---------QSVEGEMLTLSKITRSEMGAYMCIASNG--VPPTVSKRMKLQVHFHPLV 313
            .:.:.|.         ..:...:||:...:....|.|.|:..||  ...||::           |
 Worm    92 LNVEEKLLNFGKAIVDTGIVASILTIQCPSAENSGTYSCVGYNGHQTIETVAE-----------V 145

  Fly   314 QVPNQLVG-------APVL---TD---------VTLICNVEASPKAINYWQRENGEMIIAGDRYA 359
            ::..:..|       ||.:   ||         .||:|...   :.:::....|.|::...|::.
 Worm   146 EIEGEASGCRSNHKSAPEIVFWTDSRFEMTGNVATLVCRAN---QQVDWVWMSNDELVKNNDKFT 207

  Fly   360 LTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRLY 405
            :....:        |.||.:...|.|.|.||::|..|:......||
 Worm   208 VLSNGD--------LVIKNIVWDDMGTYTCIARNQFGEARQETFLY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 3/13 (23%)
ig 102..195 CDD:278476 49/241 (20%)
IG_like 219..307 CDD:214653 20/98 (20%)
Ig 221..307 CDD:299845 20/96 (21%)
Ig 311..404 CDD:299845 22/111 (20%)
IG_like 327..405 CDD:214653 17/86 (20%)
zig-4NP_509335.1 I-set 47..147 CDD:254352 23/119 (19%)
Ig 65..144 CDD:143165 18/79 (23%)
IG_like 176..245 CDD:214653 16/79 (20%)
Ig <193..238 CDD:299845 13/52 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.