DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-beta and Ncam2

DIOPT Version :10

Sequence 1:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001106679.1 Gene:Ncam2 / 17968 MGIID:97282 Length:837 Species:Mus musculus


Alignment Length:328 Identity:87/328 - (26%)
Similarity:136/328 - (41%) Gaps:83/328 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PDFVIPLE--NVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITN 160
            |..::|.:  |.|..:|.:.|.||          ...||..|. ::|.:                
Mouse   209 PAIMMPQKSFNATAERGEEMTLTC----------KASGSPDPT-ISWFR---------------- 246

  Fly   161 NDRLSVQHNDY-----NTWTLNIRGVKMEDAGKYMCQ-VNTDPMKMQTATLEVVIPPDII---NE 216
            |.:|..::..|     || .|.:|.:..:|.|.|:|: .|......:.|.|:|.:.|.|:   ||
Mouse   247 NGKLIEENEKYILKGSNT-ELTVRNIINKDGGSYVCKATNKAGEDQKQAFLQVFVQPHILQLKNE 310

  Fly   217 ETSGDMMVPEGGSAKLVCRARGHPKPKITWRR-------------EDGREIIARNGSHQKTKAQS 268
            .||      |.|...|||.|.|.|.|:|||:|             .|||  |...|.|.::.   
Mouse   311 TTS------ENGHVTLVCEAEGEPVPEITWKRAIDGVMFSEGDKSPDGR--IEVKGQHGRSS--- 364

  Fly   269 VEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLV-----GAPVLTDV 328
                 |.:..:..|:.|.|.|.|::.:... .:.|.|.:.:.|.. |.||.:     |.|    :
Mouse   365 -----LHIRDVKLSDSGRYDCEAASRIGGH-QRSMHLDIEYAPKF-VSNQTMYYSWEGNP----I 418

  Fly   329 TLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKN 393
            .:.|:|.|:|.|..:|:||  ::::....  .|..:.:....:|||.|.....:|||.|.|.:.|
Mouse   419 NISCDVTANPPASIHWRRE--KLLLPAKN--TTHLKTHSVGRKMILEIAPTSDNDFGRYNCTATN 479

  Fly   394 SIG 396
            .||
Mouse   480 RIG 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 27/118 (23%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 0/3 (0%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/5 (40%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 211..307 CDD:472250 33/111 (30%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 2/3 (67%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
IG_like 327..405 CDD:214653 21/70 (30%)
Ig strand B 328..332 CDD:409353 0/3 (0%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 3/10 (30%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353
Ncam2NP_001106679.1 IgI_1_NCAM-2 21..113 CDD:409452
Ig strand A 21..26 CDD:409452
Ig strand A' 29..33 CDD:409452
Ig strand B 35..45 CDD:409452
Ig strand C 49..55 CDD:409452
Ig strand C' 58..60 CDD:409452
Ig strand D 66..72 CDD:409452
Ig strand E 74..82 CDD:409452
Ig strand F 89..96 CDD:409452
Ig strand G 101..112 CDD:409452
IG_like 122..187 CDD:214653
Ig strand B 132..136 CDD:409353
Ig strand C 145..152 CDD:409353
Ig strand E 169..173 CDD:409353
Ig strand F 183..187 CDD:409353
Ig strand G 191..194 CDD:409353
IgI_1_MuSK 209..298 CDD:409562 26/116 (22%)
Ig strand A 209..212 CDD:409562 1/2 (50%)
Ig strand A' 217..222 CDD:409562 1/4 (25%)
Ig strand B 228..235 CDD:409562 3/16 (19%)
Ig strand C 241..246 CDD:409562 1/5 (20%)
Ig strand C' 248..250 CDD:409562 0/1 (0%)
Ig strand D 257..260 CDD:409562 1/2 (50%)
Ig strand E 264..270 CDD:409562 2/6 (33%)
Ig strand F 277..284 CDD:409562 3/6 (50%)
Ig strand G 290..298 CDD:409562 2/7 (29%)
Ig 300..397 CDD:472250 33/113 (29%)
Ig strand B 318..322 CDD:409353 1/3 (33%)
Ig strand C 331..335 CDD:409353 2/3 (67%)
Ig strand E 363..367 CDD:409353 1/11 (9%)
Ig strand F 377..382 CDD:409353 2/4 (50%)
Ig strand G 390..393 CDD:409353 0/2 (0%)
Ig_3 401..479 CDD:464046 24/86 (28%)
FN3 496..588 CDD:238020
fn3 594..678 CDD:394996
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..810
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.